diff --git a/vendor/github.com/caarlos0/env/v10/.gitignore b/vendor/github.com/caarlos0/env/v10/.gitignore new file mode 100644 index 0000000..ca6a0ff --- /dev/null +++ b/vendor/github.com/caarlos0/env/v10/.gitignore @@ -0,0 +1,4 @@ +coverage.txt +bin +card.png +dist diff --git a/vendor/github.com/caarlos0/env/v10/.golangci.yml b/vendor/github.com/caarlos0/env/v10/.golangci.yml new file mode 100644 index 0000000..ff791f8 --- /dev/null +++ b/vendor/github.com/caarlos0/env/v10/.golangci.yml @@ -0,0 +1,8 @@ +linters: + enable: + - thelper + - gofumpt + - tparallel + - unconvert + - unparam + - wastedassign diff --git a/vendor/github.com/caarlos0/env/v10/.goreleaser.yml b/vendor/github.com/caarlos0/env/v10/.goreleaser.yml new file mode 100644 index 0000000..4688983 --- /dev/null +++ b/vendor/github.com/caarlos0/env/v10/.goreleaser.yml @@ -0,0 +1,3 @@ +includes: + - from_url: + url: https://raw.githubusercontent.com/caarlos0/.goreleaserfiles/main/lib.yml diff --git a/vendor/github.com/caarlos0/env/v10/.mailmap b/vendor/github.com/caarlos0/env/v10/.mailmap new file mode 100644 index 0000000..eeeee60 --- /dev/null +++ b/vendor/github.com/caarlos0/env/v10/.mailmap @@ -0,0 +1,7 @@ +Carlos Alexandro Becker Carlos A Becker +Carlos Alexandro Becker Carlos A Becker +Carlos Alexandro Becker Carlos Alexandro Becker +Carlos Alexandro Becker Carlos Alexandro Becker +Carlos Alexandro Becker Carlos Becker +dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com> dependabot-preview[bot] <27856297+dependabot-preview[bot]@users.noreply.github.com> +actions-user github-actions[bot] <41898282+github-actions[bot]@users.noreply.github.com> diff --git a/vendor/github.com/caarlos0/env/v10/LICENSE.md b/vendor/github.com/caarlos0/env/v10/LICENSE.md new file mode 100644 index 0000000..3a59b6b --- /dev/null +++ b/vendor/github.com/caarlos0/env/v10/LICENSE.md @@ -0,0 +1,21 @@ +The MIT License (MIT) + +Copyright (c) 2015-2022 Carlos Alexandro Becker + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. diff --git a/vendor/github.com/caarlos0/env/v10/Makefile b/vendor/github.com/caarlos0/env/v10/Makefile new file mode 100644 index 0000000..da8595f --- /dev/null +++ b/vendor/github.com/caarlos0/env/v10/Makefile @@ -0,0 +1,37 @@ +SOURCE_FILES?=./... +TEST_PATTERN?=. + +export GO111MODULE := on + +setup: + go mod tidy +.PHONY: setup + +build: + go build +.PHONY: build + +test: + go test -v -failfast -race -coverpkg=./... -covermode=atomic -coverprofile=coverage.txt $(SOURCE_FILES) -run $(TEST_PATTERN) -timeout=2m +.PHONY: test + +cover: test + go tool cover -html=coverage.txt +.PHONY: cover + +fmt: + gofumpt -w -l . +.PHONY: fmt + +lint: + golangci-lint run ./... +.PHONY: lint + +ci: build test +.PHONY: ci + +card: + wget -O card.png -c "https://og.caarlos0.dev/**env**: parse envs to structs.png?theme=light&md=1&fontSize=100px&images=https://github.com/caarlos0.png" +.PHONY: card + +.DEFAULT_GOAL := ci diff --git a/vendor/github.com/caarlos0/env/v10/README.md b/vendor/github.com/caarlos0/env/v10/README.md new file mode 100644 index 0000000..fcb6342 --- /dev/null +++ b/vendor/github.com/caarlos0/env/v10/README.md @@ -0,0 +1,610 @@ +# env + +[![Build Status](https://img.shields.io/github/actions/workflow/status/caarlos0/env/build.yml?branch=main&style=for-the-badge)](https://github.com/caarlos0/env/actions?workflow=build) +[![Coverage Status](https://img.shields.io/codecov/c/gh/caarlos0/env.svg?logo=codecov&style=for-the-badge)](https://codecov.io/gh/caarlos0/env) +[![](http://img.shields.io/badge/godoc-reference-5272B4.svg?style=for-the-badge)](https://pkg.go.dev/github.com/caarlos0/env/v10) + +A simple and zero-dependencies library to parse environment variables into +`struct`s. + +## Example + +Get the module with: + +```sh +go get github.com/caarlos0/env/v10 +``` + +The usage looks like this: + +```go +package main + +import ( + "fmt" + "time" + + "github.com/caarlos0/env/v10" +) + +type config struct { + Home string `env:"HOME"` + Port int `env:"PORT" envDefault:"3000"` + Password string `env:"PASSWORD,unset"` + IsProduction bool `env:"PRODUCTION"` + Duration time.Duration `env:"DURATION"` + Hosts []string `env:"HOSTS" envSeparator:":"` + TempFolder string `env:"TEMP_FOLDER,expand" envDefault:"${HOME}/tmp"` + StringInts map[string]int `env:"MAP_STRING_INT"` +} + +func main() { + cfg := config{} + if err := env.Parse(&cfg); err != nil { + fmt.Printf("%+v\n", err) + } + + fmt.Printf("%+v\n", cfg) +} +``` + +You can run it like this: + +```sh +$ PRODUCTION=true HOSTS="host1:host2:host3" DURATION=1s MAP_STRING_INT=k1:1,k2:2 go run main.go +{Home:/your/home Port:3000 IsProduction:true Hosts:[host1 host2 host3] Duration:1s StringInts:map[k1:1 k2:2]} +``` + +## Caveats + +> **Warning** +> +> **This is important!** + +- _Unexported fields_ are **ignored** + +## Supported types and defaults + +Out of the box all built-in types are supported, plus a few others that +are commonly used. + +Complete list: + +- `string` +- `bool` +- `int` +- `int8` +- `int16` +- `int32` +- `int64` +- `uint` +- `uint8` +- `uint16` +- `uint32` +- `uint64` +- `float32` +- `float64` +- `time.Duration` +- `encoding.TextUnmarshaler` +- `url.URL` + +Pointers, slices and slices of pointers, and maps of those types are also +supported. + +You can also use/define a [custom parser func](#custom-parser-funcs) for any +other type you want. + +You can also use custom keys and values in your maps, as long as you provide a +parser function for them. + +If you set the `envDefault` tag for something, this value will be used in the +case of absence of it in the environment. + +By default, slice types will split the environment value on `,`; you can change +this behavior by setting the `envSeparator` tag. For map types, the default +separator between key and value is `:` and `,` for key-value pairs. +The behavior can be changed by setting the `envKeyValSeparator` and +`envSeparator` tags accordingly. + +## Custom Parser Funcs + +If you have a type that is not supported out of the box by the lib, you are able +to use (or define) and pass custom parsers (and their associated `reflect.Type`) +to the `env.ParseWithOptions()` function. + +In addition to accepting a struct pointer (same as `Parse()`), this function +also accepts a `Options{}`, and you can set your custom parsers in the `FuncMap` +field. + +If you add a custom parser for, say `Foo`, it will also be used to parse +`*Foo` and `[]Foo` types. + +Check the examples in the [go doc](http://pkg.go.dev/github.com/caarlos0/env/v10) +for more info. + +### A note about `TextUnmarshaler` and `time.Time` + +Env supports by default anything that implements the `TextUnmarshaler` interface. +That includes things like `time.Time` for example. +The upside is that depending on the format you need, you don't need to change +anything. +The downside is that if you do need time in another format, you'll need to +create your own type. + +Its fairly straightforward: + +```go +type MyTime time.Time + +func (t *MyTime) UnmarshalText(text []byte) error { + tt, err := time.Parse("2006-01-02", string(text)) + *t = MyTime(tt) + return err +} + +type Config struct { + SomeTime MyTime `env:"SOME_TIME"` +} +``` + +And then you can parse `Config` with `env.Parse`. + +## Required fields + +The `env` tag option `required` (e.g., `env:"tagKey,required"`) can be added to +ensure that some environment variable is set. In the example above, an error is +returned if the `config` struct is changed to: + +```go +type config struct { + SecretKey string `env:"SECRET_KEY,required"` +} +``` + +> **Warning** +> +> Note that being set is not the same as being empty. +> If the variable is set, but empty, the field will have its type's default +> value. +> This also means that custom parser funcs will not be invoked. + +## Expand vars + +If you set the `expand` option, environment variables (either in `${var}` or +`$var` format) in the string will be replaced according with the actual value +of the variable. For example: + +```go +type config struct { + SecretKey string `env:"SECRET_KEY,expand"` +} +``` + +This also works with `envDefault`: + +```go +import ( + "fmt" + "github.com/caarlos0/env/v10" +) + +type config struct { + Host string `env:"HOST" envDefault:"localhost"` + Port int `env:"PORT" envDefault:"3000"` + Address string `env:"ADDRESS,expand" envDefault:"$HOST:${PORT}"` +} + +func main() { + cfg := config{} + if err := env.Parse(&cfg); err != nil { + fmt.Printf("%+v\n", err) + } + fmt.Printf("%+v\n", cfg) +} +``` + +results in this: + +```sh +$ PORT=8080 go run main.go +{Host:localhost Port:8080 Address:localhost:8080} +``` + +## Not Empty fields + +While `required` demands the environment variable to be set, it doesn't check +its value. If you want to make sure the environment is set and not empty, you +need to use the `notEmpty` tag option instead (`env:"SOME_ENV,notEmpty"`). + +Example: + +```go +type config struct { + SecretKey string `env:"SECRET_KEY,notEmpty"` +} +``` + +## Unset environment variable after reading it + +The `env` tag option `unset` (e.g., `env:"tagKey,unset"`) can be added +to ensure that some environment variable is unset after reading it. + +Example: + +```go +type config struct { + SecretKey string `env:"SECRET_KEY,unset"` +} +``` + +## From file + +The `env` tag option `file` (e.g., `env:"tagKey,file"`) can be added +in order to indicate that the value of the variable shall be loaded from a +file. +The path of that file is given by the environment variable associated with it: + +```go +package main + +import ( + "fmt" + "time" + + "github.com/caarlos0/env/v10" +) + +type config struct { + Secret string `env:"SECRET,file"` + Password string `env:"PASSWORD,file" envDefault:"/tmp/password"` + Certificate string `env:"CERTIFICATE,file,expand" envDefault:"${CERTIFICATE_FILE}"` +} + +func main() { + cfg := config{} + if err := env.Parse(&cfg); err != nil { + fmt.Printf("%+v\n", err) + } + + fmt.Printf("%+v\n", cfg) +} +``` + +```sh +$ echo qwerty > /tmp/secret +$ echo dvorak > /tmp/password +$ echo coleman > /tmp/certificate + +$ SECRET=/tmp/secret \ + CERTIFICATE_FILE=/tmp/certificate \ + go run main.go +{Secret:qwerty Password:dvorak Certificate:coleman} +``` + +## Options + +### Use field names as environment variables by default + +If you don't want to set the `env` tag on every field, you can use the +`UseFieldNameByDefault` option. + +It will use the field name as environment variable name. + +Here's an example: + +```go +package main + +import ( + "fmt" + "log" + + "github.com/caarlos0/env/v10" +) + +type Config struct { + Username string // will use $USERNAME + Password string // will use $PASSWORD + UserFullName string // will use $USER_FULL_NAME +} + +func main() { + cfg := &Config{} + opts := env.Options{UseFieldNameByDefault: true} + + // Load env vars. + if err := env.ParseWithOptions(cfg, opts); err != nil { + log.Fatal(err) + } + + // Print the loaded data. + fmt.Printf("%+v\n", cfg) +} +``` + +### Environment + +By setting the `Options.Environment` map you can tell `Parse` to add those +`keys` and `values` as `env` vars before parsing is done. +These `envs` are stored in the map and never actually set by `os.Setenv`. +This option effectively makes `env` ignore the OS environment variables: only +the ones provided in the option are used. + +This can make your testing scenarios a bit more clean and easy to handle. + +```go +package main + +import ( + "fmt" + "log" + + "github.com/caarlos0/env/v10" +) + +type Config struct { + Password string `env:"PASSWORD"` +} + +func main() { + cfg := &Config{} + opts := env.Options{Environment: map[string]string{ + "PASSWORD": "MY_PASSWORD", + }} + + // Load env vars. + if err := env.ParseWithOptions(cfg, opts); err != nil { + log.Fatal(err) + } + + // Print the loaded data. + fmt.Printf("%+v\n", cfg) +} +``` + +### Changing default tag name + +You can change what tag name to use for setting the env vars by setting the +`Options.TagName` variable. + +For example + +```go +package main + +import ( + "fmt" + "log" + + "github.com/caarlos0/env/v10" +) + +type Config struct { + Password string `json:"PASSWORD"` +} + +func main() { + cfg := &Config{} + opts := env.Options{TagName: "json"} + + // Load env vars. + if err := env.ParseWithOptions(cfg, opts); err != nil { + log.Fatal(err) + } + + // Print the loaded data. + fmt.Printf("%+v\n", cfg) +} +``` + +### Prefixes + +You can prefix sub-structs env tags, as well as a whole `env.Parse` call. + +Here's an example flexing it a bit: + +```go +package main + +import ( + "fmt" + "log" + + "github.com/caarlos0/env/v10" +) + +type Config struct { + Home string `env:"HOME"` +} + +type ComplexConfig struct { + Foo Config `envPrefix:"FOO_"` + Clean Config + Bar Config `envPrefix:"BAR_"` + Blah string `env:"BLAH"` +} + +func main() { + cfg := &ComplexConfig{} + opts := env.Options{ + Prefix: "T_", + Environment: map[string]string{ + "T_FOO_HOME": "/foo", + "T_BAR_HOME": "/bar", + "T_BLAH": "blahhh", + "T_HOME": "/clean", + }, + } + + // Load env vars. + if err := env.ParseWithOptions(cfg, opts); err != nil { + log.Fatal(err) + } + + // Print the loaded data. + fmt.Printf("%+v\n", cfg) +} +``` + +### On set hooks + +You might want to listen to value sets and, for example, log something or do +some other kind of logic. +You can do this by passing a `OnSet` option: + +```go +package main + +import ( + "fmt" + "log" + + "github.com/caarlos0/env/v10" +) + +type Config struct { + Username string `env:"USERNAME" envDefault:"admin"` + Password string `env:"PASSWORD"` +} + +func main() { + cfg := &Config{} + opts := env.Options{ + OnSet: func(tag string, value interface{}, isDefault bool) { + fmt.Printf("Set %s to %v (default? %v)\n", tag, value, isDefault) + }, + } + + // Load env vars. + if err := env.ParseWithOptions(cfg, opts); err != nil { + log.Fatal(err) + } + + // Print the loaded data. + fmt.Printf("%+v\n", cfg) +} +``` + +## Making all fields to required + +You can make all fields that don't have a default value be required by setting +the `RequiredIfNoDef: true` in the `Options`. + +For example + +```go +package main + +import ( + "fmt" + "log" + + "github.com/caarlos0/env/v10" +) + +type Config struct { + Username string `env:"USERNAME" envDefault:"admin"` + Password string `env:"PASSWORD"` +} + +func main() { + cfg := &Config{} + opts := env.Options{RequiredIfNoDef: true} + + // Load env vars. + if err := env.ParseWithOptions(cfg, opts); err != nil { + log.Fatal(err) + } + + // Print the loaded data. + fmt.Printf("%+v\n", cfg) +} +``` + +## Defaults from code + +You may define default value also in code, by initialising the config data +before it's filled by `env.Parse`. +Default values defined as struct tags will overwrite existing values during +Parse. + +```go +package main + +import ( + "fmt" + "log" + + "github.com/caarlos0/env/v10" +) + +type Config struct { + Username string `env:"USERNAME" envDefault:"admin"` + Password string `env:"PASSWORD"` +} + +func main() { + cfg := Config{ + Username: "test", + Password: "123456", + } + + if err := env.Parse(&cfg); err != nil { + fmt.Println("failed:", err) + } + + fmt.Printf("%+v", cfg) // {Username:admin Password:123456} +} +``` + +## Error handling + +You can handle the errors the library throws like so: + +```go +package main + +import ( + "fmt" + "log" + + "github.com/caarlos0/env/v10" +) + +type Config struct { + Username string `env:"USERNAME" envDefault:"admin"` + Password string `env:"PASSWORD"` +} + +func main() { + var cfg Config + err := env.Parse(&cfg) + if e, ok := err.(*env.AggregateError); ok { + for _, er := range e.Errors { + switch v := er.(type) { + case env.ParseError: + // handle it + case env.NotStructPtrError: + // handle it + case env.NoParserError: + // handle it + case env.NoSupportedTagOptionError: + // handle it + default: + fmt.Printf("Unknown error type %v", v) + } + } + } + + fmt.Printf("%+v", cfg) // {Username:admin Password:123456} +} +``` + +> **Info** +> +> If you want to check if an specific error is in the chain, you can also use +> `errors.Is()`. + +## Stargazers over time + +[![Stargazers over time](https://starchart.cc/caarlos0/env.svg)](https://starchart.cc/caarlos0/env) diff --git a/vendor/github.com/caarlos0/env/v10/env.go b/vendor/github.com/caarlos0/env/v10/env.go new file mode 100644 index 0000000..5c9d806 --- /dev/null +++ b/vendor/github.com/caarlos0/env/v10/env.go @@ -0,0 +1,614 @@ +package env + +import ( + "encoding" + "fmt" + "net/url" + "os" + "reflect" + "strconv" + "strings" + "time" + "unicode" +) + +// nolint: gochecknoglobals +var ( + defaultBuiltInParsers = map[reflect.Kind]ParserFunc{ + reflect.Bool: func(v string) (interface{}, error) { + return strconv.ParseBool(v) + }, + reflect.String: func(v string) (interface{}, error) { + return v, nil + }, + reflect.Int: func(v string) (interface{}, error) { + i, err := strconv.ParseInt(v, 10, 32) + return int(i), err + }, + reflect.Int16: func(v string) (interface{}, error) { + i, err := strconv.ParseInt(v, 10, 16) + return int16(i), err + }, + reflect.Int32: func(v string) (interface{}, error) { + i, err := strconv.ParseInt(v, 10, 32) + return int32(i), err + }, + reflect.Int64: func(v string) (interface{}, error) { + return strconv.ParseInt(v, 10, 64) + }, + reflect.Int8: func(v string) (interface{}, error) { + i, err := strconv.ParseInt(v, 10, 8) + return int8(i), err + }, + reflect.Uint: func(v string) (interface{}, error) { + i, err := strconv.ParseUint(v, 10, 32) + return uint(i), err + }, + reflect.Uint16: func(v string) (interface{}, error) { + i, err := strconv.ParseUint(v, 10, 16) + return uint16(i), err + }, + reflect.Uint32: func(v string) (interface{}, error) { + i, err := strconv.ParseUint(v, 10, 32) + return uint32(i), err + }, + reflect.Uint64: func(v string) (interface{}, error) { + i, err := strconv.ParseUint(v, 10, 64) + return i, err + }, + reflect.Uint8: func(v string) (interface{}, error) { + i, err := strconv.ParseUint(v, 10, 8) + return uint8(i), err + }, + reflect.Float64: func(v string) (interface{}, error) { + return strconv.ParseFloat(v, 64) + }, + reflect.Float32: func(v string) (interface{}, error) { + f, err := strconv.ParseFloat(v, 32) + return float32(f), err + }, + } +) + +func defaultTypeParsers() map[reflect.Type]ParserFunc { + return map[reflect.Type]ParserFunc{ + reflect.TypeOf(url.URL{}): func(v string) (interface{}, error) { + u, err := url.Parse(v) + if err != nil { + return nil, newParseValueError("unable to parse URL", err) + } + return *u, nil + }, + reflect.TypeOf(time.Nanosecond): func(v string) (interface{}, error) { + s, err := time.ParseDuration(v) + if err != nil { + return nil, newParseValueError("unable to parse duration", err) + } + return s, err + }, + } +} + +// ParserFunc defines the signature of a function that can be used within `CustomParsers`. +type ParserFunc func(v string) (interface{}, error) + +// OnSetFn is a hook that can be run when a value is set. +type OnSetFn func(tag string, value interface{}, isDefault bool) + +// processFieldFn is a function which takes all information about a field and processes it. +type processFieldFn func(refField reflect.Value, refTypeField reflect.StructField, opts Options, fieldParams FieldParams) error + +// Options for the parser. +type Options struct { + // Environment keys and values that will be accessible for the service. + Environment map[string]string + + // TagName specifies another tagname to use rather than the default env. + TagName string + + // RequiredIfNoDef automatically sets all env as required if they do not + // declare 'envDefault'. + RequiredIfNoDef bool + + // OnSet allows to run a function when a value is set. + OnSet OnSetFn + + // Prefix define a prefix for each key. + Prefix string + + // UseFieldNameByDefault defines whether or not env should use the field + // name by default if the `env` key is missing. + UseFieldNameByDefault bool + + // Custom parse functions for different types. + FuncMap map[reflect.Type]ParserFunc + + // Used internally. maps the env variable key to its resolved string value. (for env var expansion) + rawEnvVars map[string]string +} + +func (opts *Options) getRawEnv(s string) string { + val := opts.rawEnvVars[s] + if val == "" { + return opts.Environment[s] + } + return val +} + +func defaultOptions() Options { + return Options{ + TagName: "env", + Environment: toMap(os.Environ()), + FuncMap: defaultTypeParsers(), + rawEnvVars: make(map[string]string), + } +} + +func customOptions(opt Options) Options { + defOpts := defaultOptions() + if opt.TagName == "" { + opt.TagName = defOpts.TagName + } + if opt.Environment == nil { + opt.Environment = defOpts.Environment + } + if opt.FuncMap == nil { + opt.FuncMap = map[reflect.Type]ParserFunc{} + } + if opt.rawEnvVars == nil { + opt.rawEnvVars = defOpts.rawEnvVars + } + for k, v := range defOpts.FuncMap { + if _, exists := opt.FuncMap[k]; !exists { + opt.FuncMap[k] = v + } + } + return opt +} + +func optionsWithEnvPrefix(field reflect.StructField, opts Options) Options { + return Options{ + Environment: opts.Environment, + TagName: opts.TagName, + RequiredIfNoDef: opts.RequiredIfNoDef, + OnSet: opts.OnSet, + Prefix: opts.Prefix + field.Tag.Get("envPrefix"), + UseFieldNameByDefault: opts.UseFieldNameByDefault, + FuncMap: opts.FuncMap, + rawEnvVars: opts.rawEnvVars, + } +} + +// Parse parses a struct containing `env` tags and loads its values from +// environment variables. +func Parse(v interface{}) error { + return parseInternal(v, setField, defaultOptions()) +} + +// ParseWithOptions parses a struct containing `env` tags and loads its values from +// environment variables. +func ParseWithOptions(v interface{}, opts Options) error { + return parseInternal(v, setField, customOptions(opts)) +} + +// GetFieldParams parses a struct containing `env` tags and returns information about +// tags it found. +func GetFieldParams(v interface{}) ([]FieldParams, error) { + return GetFieldParamsWithOptions(v, defaultOptions()) +} + +// GetFieldParamsWithOptions parses a struct containing `env` tags and returns information about +// tags it found. +func GetFieldParamsWithOptions(v interface{}, opts Options) ([]FieldParams, error) { + var result []FieldParams + err := parseInternal( + v, + func(_ reflect.Value, _ reflect.StructField, _ Options, fieldParams FieldParams) error { + if fieldParams.OwnKey != "" { + result = append(result, fieldParams) + } + return nil + }, + customOptions(opts), + ) + if err != nil { + return nil, err + } + + return result, nil +} + +func parseInternal(v interface{}, processField processFieldFn, opts Options) error { + ptrRef := reflect.ValueOf(v) + if ptrRef.Kind() != reflect.Ptr { + return newAggregateError(NotStructPtrError{}) + } + ref := ptrRef.Elem() + if ref.Kind() != reflect.Struct { + return newAggregateError(NotStructPtrError{}) + } + + return doParse(ref, processField, opts) +} + +func doParse(ref reflect.Value, processField processFieldFn, opts Options) error { + refType := ref.Type() + + var agrErr AggregateError + + for i := 0; i < refType.NumField(); i++ { + refField := ref.Field(i) + refTypeField := refType.Field(i) + + if err := doParseField(refField, refTypeField, processField, opts); err != nil { + if val, ok := err.(AggregateError); ok { + agrErr.Errors = append(agrErr.Errors, val.Errors...) + } else { + agrErr.Errors = append(agrErr.Errors, err) + } + } + } + + if len(agrErr.Errors) == 0 { + return nil + } + + return agrErr +} + +func doParseField(refField reflect.Value, refTypeField reflect.StructField, processField processFieldFn, opts Options) error { + if !refField.CanSet() { + return nil + } + if reflect.Ptr == refField.Kind() && !refField.IsNil() { + return parseInternal(refField.Interface(), processField, optionsWithEnvPrefix(refTypeField, opts)) + } + if reflect.Struct == refField.Kind() && refField.CanAddr() && refField.Type().Name() == "" { + return parseInternal(refField.Addr().Interface(), processField, optionsWithEnvPrefix(refTypeField, opts)) + } + + params, err := parseFieldParams(refTypeField, opts) + if err != nil { + return err + } + + if err := processField(refField, refTypeField, opts, params); err != nil { + return err + } + + if reflect.Struct == refField.Kind() { + return doParse(refField, processField, optionsWithEnvPrefix(refTypeField, opts)) + } + + return nil +} + +func setField(refField reflect.Value, refTypeField reflect.StructField, opts Options, fieldParams FieldParams) error { + value, err := get(fieldParams, opts) + if err != nil { + return err + } + + if value != "" { + return set(refField, refTypeField, value, opts.FuncMap) + } + + return nil +} + +const underscore rune = '_' + +func toEnvName(input string) string { + var output []rune + for i, c := range input { + if i > 0 && output[i-1] != underscore && c != underscore && unicode.ToUpper(c) == c { + output = append(output, underscore) + } + output = append(output, unicode.ToUpper(c)) + } + return string(output) +} + +// FieldParams contains information about parsed field tags. +type FieldParams struct { + OwnKey string + Key string + DefaultValue string + HasDefaultValue bool + Required bool + LoadFile bool + Unset bool + NotEmpty bool + Expand bool +} + +func parseFieldParams(field reflect.StructField, opts Options) (FieldParams, error) { + ownKey, tags := parseKeyForOption(field.Tag.Get(opts.TagName)) + if ownKey == "" && opts.UseFieldNameByDefault { + ownKey = toEnvName(field.Name) + } + + defaultValue, hasDefaultValue := field.Tag.Lookup("envDefault") + + result := FieldParams{ + OwnKey: ownKey, + Key: opts.Prefix + ownKey, + Required: opts.RequiredIfNoDef, + DefaultValue: defaultValue, + HasDefaultValue: hasDefaultValue, + } + + for _, tag := range tags { + switch tag { + case "": + continue + case "file": + result.LoadFile = true + case "required": + result.Required = true + case "unset": + result.Unset = true + case "notEmpty": + result.NotEmpty = true + case "expand": + result.Expand = true + default: + return FieldParams{}, newNoSupportedTagOptionError(tag) + } + } + + return result, nil +} + +func get(fieldParams FieldParams, opts Options) (val string, err error) { + var exists, isDefault bool + + val, exists, isDefault = getOr(fieldParams.Key, fieldParams.DefaultValue, fieldParams.HasDefaultValue, opts.Environment) + + if fieldParams.Expand { + val = os.Expand(val, opts.getRawEnv) + } + + opts.rawEnvVars[fieldParams.OwnKey] = val + + if fieldParams.Unset { + defer os.Unsetenv(fieldParams.Key) + } + + if fieldParams.Required && !exists && len(fieldParams.OwnKey) > 0 { + return "", newEnvVarIsNotSet(fieldParams.Key) + } + + if fieldParams.NotEmpty && val == "" { + return "", newEmptyEnvVarError(fieldParams.Key) + } + + if fieldParams.LoadFile && val != "" { + filename := val + val, err = getFromFile(filename) + if err != nil { + return "", newLoadFileContentError(filename, fieldParams.Key, err) + } + } + + if opts.OnSet != nil { + if fieldParams.OwnKey != "" { + opts.OnSet(fieldParams.Key, val, isDefault) + } + } + return val, err +} + +// split the env tag's key into the expected key and desired option, if any. +func parseKeyForOption(key string) (string, []string) { + opts := strings.Split(key, ",") + return opts[0], opts[1:] +} + +func getFromFile(filename string) (value string, err error) { + b, err := os.ReadFile(filename) + return string(b), err +} + +func getOr(key, defaultValue string, defExists bool, envs map[string]string) (val string, exists bool, isDefault bool) { + value, exists := envs[key] + switch { + case (!exists || key == "") && defExists: + return defaultValue, true, true + case exists && value == "" && defExists: + return defaultValue, true, true + case !exists: + return "", false, false + } + + return value, true, false +} + +func set(field reflect.Value, sf reflect.StructField, value string, funcMap map[reflect.Type]ParserFunc) error { + if tm := asTextUnmarshaler(field); tm != nil { + if err := tm.UnmarshalText([]byte(value)); err != nil { + return newParseError(sf, err) + } + return nil + } + + typee := sf.Type + fieldee := field + if typee.Kind() == reflect.Ptr { + typee = typee.Elem() + fieldee = field.Elem() + } + + parserFunc, ok := funcMap[typee] + if ok { + val, err := parserFunc(value) + if err != nil { + return newParseError(sf, err) + } + + fieldee.Set(reflect.ValueOf(val)) + return nil + } + + parserFunc, ok = defaultBuiltInParsers[typee.Kind()] + if ok { + val, err := parserFunc(value) + if err != nil { + return newParseError(sf, err) + } + + fieldee.Set(reflect.ValueOf(val).Convert(typee)) + return nil + } + + switch field.Kind() { + case reflect.Slice: + return handleSlice(field, value, sf, funcMap) + case reflect.Map: + return handleMap(field, value, sf, funcMap) + } + + return newNoParserError(sf) +} + +func handleSlice(field reflect.Value, value string, sf reflect.StructField, funcMap map[reflect.Type]ParserFunc) error { + separator := sf.Tag.Get("envSeparator") + if separator == "" { + separator = "," + } + parts := strings.Split(value, separator) + + typee := sf.Type.Elem() + if typee.Kind() == reflect.Ptr { + typee = typee.Elem() + } + + if _, ok := reflect.New(typee).Interface().(encoding.TextUnmarshaler); ok { + return parseTextUnmarshalers(field, parts, sf) + } + + parserFunc, ok := funcMap[typee] + if !ok { + parserFunc, ok = defaultBuiltInParsers[typee.Kind()] + if !ok { + return newNoParserError(sf) + } + } + + result := reflect.MakeSlice(sf.Type, 0, len(parts)) + for _, part := range parts { + r, err := parserFunc(part) + if err != nil { + return newParseError(sf, err) + } + v := reflect.ValueOf(r).Convert(typee) + if sf.Type.Elem().Kind() == reflect.Ptr { + v = reflect.New(typee) + v.Elem().Set(reflect.ValueOf(r).Convert(typee)) + } + result = reflect.Append(result, v) + } + field.Set(result) + return nil +} + +func handleMap(field reflect.Value, value string, sf reflect.StructField, funcMap map[reflect.Type]ParserFunc) error { + keyType := sf.Type.Key() + keyParserFunc, ok := funcMap[keyType] + if !ok { + keyParserFunc, ok = defaultBuiltInParsers[keyType.Kind()] + if !ok { + return newNoParserError(sf) + } + } + + elemType := sf.Type.Elem() + elemParserFunc, ok := funcMap[elemType] + if !ok { + elemParserFunc, ok = defaultBuiltInParsers[elemType.Kind()] + if !ok { + return newNoParserError(sf) + } + } + + separator := sf.Tag.Get("envSeparator") + if separator == "" { + separator = "," + } + + keyValSeparator := sf.Tag.Get("envKeyValSeparator") + if keyValSeparator == "" { + keyValSeparator = ":" + } + + result := reflect.MakeMap(sf.Type) + for _, part := range strings.Split(value, separator) { + pairs := strings.Split(part, keyValSeparator) + if len(pairs) != 2 { + return newParseError(sf, fmt.Errorf(`%q should be in "key%svalue" format`, part, keyValSeparator)) + } + + key, err := keyParserFunc(pairs[0]) + if err != nil { + return newParseError(sf, err) + } + + elem, err := elemParserFunc(pairs[1]) + if err != nil { + return newParseError(sf, err) + } + + result.SetMapIndex(reflect.ValueOf(key).Convert(keyType), reflect.ValueOf(elem).Convert(elemType)) + } + + field.Set(result) + return nil +} + +func asTextUnmarshaler(field reflect.Value) encoding.TextUnmarshaler { + if reflect.Ptr == field.Kind() { + if field.IsNil() { + field.Set(reflect.New(field.Type().Elem())) + } + } else if field.CanAddr() { + field = field.Addr() + } + + tm, ok := field.Interface().(encoding.TextUnmarshaler) + if !ok { + return nil + } + return tm +} + +func parseTextUnmarshalers(field reflect.Value, data []string, sf reflect.StructField) error { + s := len(data) + elemType := field.Type().Elem() + slice := reflect.MakeSlice(reflect.SliceOf(elemType), s, s) + for i, v := range data { + sv := slice.Index(i) + kind := sv.Kind() + if kind == reflect.Ptr { + sv = reflect.New(elemType.Elem()) + } else { + sv = sv.Addr() + } + tm := sv.Interface().(encoding.TextUnmarshaler) + if err := tm.UnmarshalText([]byte(v)); err != nil { + return newParseError(sf, err) + } + if kind == reflect.Ptr { + slice.Index(i).Set(sv) + } + } + + field.Set(slice) + + return nil +} + +// ToMap Converts list of env vars as provided by os.Environ() to map you +// can use as Options.Environment field +func ToMap(env []string) map[string]string { + return toMap(env) +} diff --git a/vendor/github.com/caarlos0/env/v10/env_tomap.go b/vendor/github.com/caarlos0/env/v10/env_tomap.go new file mode 100644 index 0000000..aece2ae --- /dev/null +++ b/vendor/github.com/caarlos0/env/v10/env_tomap.go @@ -0,0 +1,16 @@ +//go:build !windows + +package env + +import "strings" + +func toMap(env []string) map[string]string { + r := map[string]string{} + for _, e := range env { + p := strings.SplitN(e, "=", 2) + if len(p) == 2 { + r[p[0]] = p[1] + } + } + return r +} diff --git a/vendor/github.com/caarlos0/env/v10/env_tomap_windows.go b/vendor/github.com/caarlos0/env/v10/env_tomap_windows.go new file mode 100644 index 0000000..04ce66f --- /dev/null +++ b/vendor/github.com/caarlos0/env/v10/env_tomap_windows.go @@ -0,0 +1,29 @@ +//go:build windows + +package env + +import "strings" + +func toMap(env []string) map[string]string { + r := map[string]string{} + for _, e := range env { + p := strings.SplitN(e, "=", 2) + + // On Windows, environment variables can start with '='. If so, Split at next character. + // See env_windows.go in the Go source: https://github.com/golang/go/blob/master/src/syscall/env_windows.go#L58 + prefixEqualSign := false + if len(e) > 0 && e[0] == '=' { + e = e[1:] + prefixEqualSign = true + } + p = strings.SplitN(e, "=", 2) + if prefixEqualSign { + p[0] = "=" + p[0] + } + + if len(p) == 2 { + r[p[0]] = p[1] + } + } + return r +} diff --git a/vendor/github.com/caarlos0/env/v10/error.go b/vendor/github.com/caarlos0/env/v10/error.go new file mode 100644 index 0000000..156ca3e --- /dev/null +++ b/vendor/github.com/caarlos0/env/v10/error.go @@ -0,0 +1,164 @@ +package env + +import ( + "fmt" + "reflect" + "strings" +) + +// An aggregated error wrapper to combine gathered errors. This allows either to display all errors or convert them individually +// List of the available errors +// ParseError +// NotStructPtrError +// NoParserError +// NoSupportedTagOptionError +// EnvVarIsNotSetError +// EmptyEnvVarError +// LoadFileContentError +// ParseValueError +type AggregateError struct { + Errors []error +} + +func newAggregateError(initErr error) error { + return AggregateError{ + []error{ + initErr, + }, + } +} + +func (e AggregateError) Error() string { + var sb strings.Builder + + sb.WriteString("env:") + + for _, err := range e.Errors { + sb.WriteString(fmt.Sprintf(" %v;", err.Error())) + } + + return strings.TrimRight(sb.String(), ";") +} + +// Is conforms with errors.Is. +func (e AggregateError) Is(err error) bool { + for _, ie := range e.Errors { + if reflect.TypeOf(ie) == reflect.TypeOf(err) { + return true + } + } + return false +} + +// The error occurs when it's impossible to convert the value for given type. +type ParseError struct { + Name string + Type reflect.Type + Err error +} + +func newParseError(sf reflect.StructField, err error) error { + return ParseError{sf.Name, sf.Type, err} +} + +func (e ParseError) Error() string { + return fmt.Sprintf(`parse error on field "%s" of type "%s": %v`, e.Name, e.Type, e.Err) +} + +// The error occurs when pass something that is not a pointer to a Struct to Parse +type NotStructPtrError struct{} + +func (e NotStructPtrError) Error() string { + return "expected a pointer to a Struct" +} + +// This error occurs when there is no parser provided for given type +// Supported types and defaults: https://github.com/caarlos0/env#supported-types-and-defaults +// How to create a custom parser: https://github.com/caarlos0/env#custom-parser-funcs +type NoParserError struct { + Name string + Type reflect.Type +} + +func newNoParserError(sf reflect.StructField) error { + return NoParserError{sf.Name, sf.Type} +} + +func (e NoParserError) Error() string { + return fmt.Sprintf(`no parser found for field "%s" of type "%s"`, e.Name, e.Type) +} + +// This error occurs when the given tag is not supported +// In-built supported tags: "", "file", "required", "unset", "notEmpty", "expand", "envDefault", "envSeparator" +// How to create a custom tag: https://github.com/caarlos0/env#changing-default-tag-name +type NoSupportedTagOptionError struct { + Tag string +} + +func newNoSupportedTagOptionError(tag string) error { + return NoSupportedTagOptionError{tag} +} + +func (e NoSupportedTagOptionError) Error() string { + return fmt.Sprintf("tag option %q not supported", e.Tag) +} + +// This error occurs when the required variable is not set +// Read about required fields: https://github.com/caarlos0/env#required-fields +type EnvVarIsNotSetError struct { + Key string +} + +func newEnvVarIsNotSet(key string) error { + return EnvVarIsNotSetError{key} +} + +func (e EnvVarIsNotSetError) Error() string { + return fmt.Sprintf(`required environment variable %q is not set`, e.Key) +} + +// This error occurs when the variable which must be not empty is existing but has an empty value +// Read about not empty fields: https://github.com/caarlos0/env#not-empty-fields +type EmptyEnvVarError struct { + Key string +} + +func newEmptyEnvVarError(key string) error { + return EmptyEnvVarError{key} +} + +func (e EmptyEnvVarError) Error() string { + return fmt.Sprintf("environment variable %q should not be empty", e.Key) +} + +// This error occurs when it's impossible to load the value from the file +// Read about From file feature: https://github.com/caarlos0/env#from-file +type LoadFileContentError struct { + Filename string + Key string + Err error +} + +func newLoadFileContentError(filename, key string, err error) error { + return LoadFileContentError{filename, key, err} +} + +func (e LoadFileContentError) Error() string { + return fmt.Sprintf(`could not load content of file "%s" from variable %s: %v`, e.Filename, e.Key, e.Err) +} + +// This error occurs when it's impossible to convert value using given parser +// Supported types and defaults: https://github.com/caarlos0/env#supported-types-and-defaults +// How to create a custom parser: https://github.com/caarlos0/env#custom-parser-funcs +type ParseValueError struct { + Msg string + Err error +} + +func newParseValueError(message string, err error) error { + return ParseValueError{message, err} +} + +func (e ParseValueError) Error() string { + return fmt.Sprintf("%s: %v", e.Msg, e.Err) +} diff --git a/vendor/github.com/google/go-cmp/LICENSE b/vendor/github.com/google/go-cmp/LICENSE new file mode 100644 index 0000000..32017f8 --- /dev/null +++ b/vendor/github.com/google/go-cmp/LICENSE @@ -0,0 +1,27 @@ +Copyright (c) 2017 The Go Authors. All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/github.com/google/go-cmp/cmp/compare.go b/vendor/github.com/google/go-cmp/cmp/compare.go new file mode 100644 index 0000000..0f5b8a4 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/compare.go @@ -0,0 +1,671 @@ +// Copyright 2017, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package cmp determines equality of values. +// +// This package is intended to be a more powerful and safer alternative to +// [reflect.DeepEqual] for comparing whether two values are semantically equal. +// It is intended to only be used in tests, as performance is not a goal and +// it may panic if it cannot compare the values. Its propensity towards +// panicking means that its unsuitable for production environments where a +// spurious panic may be fatal. +// +// The primary features of cmp are: +// +// - When the default behavior of equality does not suit the test's needs, +// custom equality functions can override the equality operation. +// For example, an equality function may report floats as equal so long as +// they are within some tolerance of each other. +// +// - Types with an Equal method (e.g., [time.Time.Equal]) may use that method +// to determine equality. This allows package authors to determine +// the equality operation for the types that they define. +// +// - If no custom equality functions are used and no Equal method is defined, +// equality is determined by recursively comparing the primitive kinds on +// both values, much like [reflect.DeepEqual]. Unlike [reflect.DeepEqual], +// unexported fields are not compared by default; they result in panics +// unless suppressed by using an [Ignore] option +// (see [github.com/google/go-cmp/cmp/cmpopts.IgnoreUnexported]) +// or explicitly compared using the [Exporter] option. +package cmp + +import ( + "fmt" + "reflect" + "strings" + + "github.com/google/go-cmp/cmp/internal/diff" + "github.com/google/go-cmp/cmp/internal/function" + "github.com/google/go-cmp/cmp/internal/value" +) + +// TODO(≥go1.18): Use any instead of interface{}. + +// Equal reports whether x and y are equal by recursively applying the +// following rules in the given order to x and y and all of their sub-values: +// +// - Let S be the set of all [Ignore], [Transformer], and [Comparer] options that +// remain after applying all path filters, value filters, and type filters. +// If at least one [Ignore] exists in S, then the comparison is ignored. +// If the number of [Transformer] and [Comparer] options in S is non-zero, +// then Equal panics because it is ambiguous which option to use. +// If S contains a single [Transformer], then use that to transform +// the current values and recursively call Equal on the output values. +// If S contains a single [Comparer], then use that to compare the current values. +// Otherwise, evaluation proceeds to the next rule. +// +// - If the values have an Equal method of the form "(T) Equal(T) bool" or +// "(T) Equal(I) bool" where T is assignable to I, then use the result of +// x.Equal(y) even if x or y is nil. Otherwise, no such method exists and +// evaluation proceeds to the next rule. +// +// - Lastly, try to compare x and y based on their basic kinds. +// Simple kinds like booleans, integers, floats, complex numbers, strings, +// and channels are compared using the equivalent of the == operator in Go. +// Functions are only equal if they are both nil, otherwise they are unequal. +// +// Structs are equal if recursively calling Equal on all fields report equal. +// If a struct contains unexported fields, Equal panics unless an [Ignore] option +// (e.g., [github.com/google/go-cmp/cmp/cmpopts.IgnoreUnexported]) ignores that field +// or the [Exporter] option explicitly permits comparing the unexported field. +// +// Slices are equal if they are both nil or both non-nil, where recursively +// calling Equal on all non-ignored slice or array elements report equal. +// Empty non-nil slices and nil slices are not equal; to equate empty slices, +// consider using [github.com/google/go-cmp/cmp/cmpopts.EquateEmpty]. +// +// Maps are equal if they are both nil or both non-nil, where recursively +// calling Equal on all non-ignored map entries report equal. +// Map keys are equal according to the == operator. +// To use custom comparisons for map keys, consider using +// [github.com/google/go-cmp/cmp/cmpopts.SortMaps]. +// Empty non-nil maps and nil maps are not equal; to equate empty maps, +// consider using [github.com/google/go-cmp/cmp/cmpopts.EquateEmpty]. +// +// Pointers and interfaces are equal if they are both nil or both non-nil, +// where they have the same underlying concrete type and recursively +// calling Equal on the underlying values reports equal. +// +// Before recursing into a pointer, slice element, or map, the current path +// is checked to detect whether the address has already been visited. +// If there is a cycle, then the pointed at values are considered equal +// only if both addresses were previously visited in the same path step. +func Equal(x, y interface{}, opts ...Option) bool { + s := newState(opts) + s.compareAny(rootStep(x, y)) + return s.result.Equal() +} + +// Diff returns a human-readable report of the differences between two values: +// y - x. It returns an empty string if and only if Equal returns true for the +// same input values and options. +// +// The output is displayed as a literal in pseudo-Go syntax. +// At the start of each line, a "-" prefix indicates an element removed from x, +// a "+" prefix to indicates an element added from y, and the lack of a prefix +// indicates an element common to both x and y. If possible, the output +// uses fmt.Stringer.String or error.Error methods to produce more humanly +// readable outputs. In such cases, the string is prefixed with either an +// 's' or 'e' character, respectively, to indicate that the method was called. +// +// Do not depend on this output being stable. If you need the ability to +// programmatically interpret the difference, consider using a custom Reporter. +func Diff(x, y interface{}, opts ...Option) string { + s := newState(opts) + + // Optimization: If there are no other reporters, we can optimize for the + // common case where the result is equal (and thus no reported difference). + // This avoids the expensive construction of a difference tree. + if len(s.reporters) == 0 { + s.compareAny(rootStep(x, y)) + if s.result.Equal() { + return "" + } + s.result = diff.Result{} // Reset results + } + + r := new(defaultReporter) + s.reporters = append(s.reporters, reporter{r}) + s.compareAny(rootStep(x, y)) + d := r.String() + if (d == "") != s.result.Equal() { + panic("inconsistent difference and equality results") + } + return d +} + +// rootStep constructs the first path step. If x and y have differing types, +// then they are stored within an empty interface type. +func rootStep(x, y interface{}) PathStep { + vx := reflect.ValueOf(x) + vy := reflect.ValueOf(y) + + // If the inputs are different types, auto-wrap them in an empty interface + // so that they have the same parent type. + var t reflect.Type + if !vx.IsValid() || !vy.IsValid() || vx.Type() != vy.Type() { + t = anyType + if vx.IsValid() { + vvx := reflect.New(t).Elem() + vvx.Set(vx) + vx = vvx + } + if vy.IsValid() { + vvy := reflect.New(t).Elem() + vvy.Set(vy) + vy = vvy + } + } else { + t = vx.Type() + } + + return &pathStep{t, vx, vy} +} + +type state struct { + // These fields represent the "comparison state". + // Calling statelessCompare must not result in observable changes to these. + result diff.Result // The current result of comparison + curPath Path // The current path in the value tree + curPtrs pointerPath // The current set of visited pointers + reporters []reporter // Optional reporters + + // recChecker checks for infinite cycles applying the same set of + // transformers upon the output of itself. + recChecker recChecker + + // dynChecker triggers pseudo-random checks for option correctness. + // It is safe for statelessCompare to mutate this value. + dynChecker dynChecker + + // These fields, once set by processOption, will not change. + exporters []exporter // List of exporters for structs with unexported fields + opts Options // List of all fundamental and filter options +} + +func newState(opts []Option) *state { + // Always ensure a validator option exists to validate the inputs. + s := &state{opts: Options{validator{}}} + s.curPtrs.Init() + s.processOption(Options(opts)) + return s +} + +func (s *state) processOption(opt Option) { + switch opt := opt.(type) { + case nil: + case Options: + for _, o := range opt { + s.processOption(o) + } + case coreOption: + type filtered interface { + isFiltered() bool + } + if fopt, ok := opt.(filtered); ok && !fopt.isFiltered() { + panic(fmt.Sprintf("cannot use an unfiltered option: %v", opt)) + } + s.opts = append(s.opts, opt) + case exporter: + s.exporters = append(s.exporters, opt) + case reporter: + s.reporters = append(s.reporters, opt) + default: + panic(fmt.Sprintf("unknown option %T", opt)) + } +} + +// statelessCompare compares two values and returns the result. +// This function is stateless in that it does not alter the current result, +// or output to any registered reporters. +func (s *state) statelessCompare(step PathStep) diff.Result { + // We do not save and restore curPath and curPtrs because all of the + // compareX methods should properly push and pop from them. + // It is an implementation bug if the contents of the paths differ from + // when calling this function to when returning from it. + + oldResult, oldReporters := s.result, s.reporters + s.result = diff.Result{} // Reset result + s.reporters = nil // Remove reporters to avoid spurious printouts + s.compareAny(step) + res := s.result + s.result, s.reporters = oldResult, oldReporters + return res +} + +func (s *state) compareAny(step PathStep) { + // Update the path stack. + s.curPath.push(step) + defer s.curPath.pop() + for _, r := range s.reporters { + r.PushStep(step) + defer r.PopStep() + } + s.recChecker.Check(s.curPath) + + // Cycle-detection for slice elements (see NOTE in compareSlice). + t := step.Type() + vx, vy := step.Values() + if si, ok := step.(SliceIndex); ok && si.isSlice && vx.IsValid() && vy.IsValid() { + px, py := vx.Addr(), vy.Addr() + if eq, visited := s.curPtrs.Push(px, py); visited { + s.report(eq, reportByCycle) + return + } + defer s.curPtrs.Pop(px, py) + } + + // Rule 1: Check whether an option applies on this node in the value tree. + if s.tryOptions(t, vx, vy) { + return + } + + // Rule 2: Check whether the type has a valid Equal method. + if s.tryMethod(t, vx, vy) { + return + } + + // Rule 3: Compare based on the underlying kind. + switch t.Kind() { + case reflect.Bool: + s.report(vx.Bool() == vy.Bool(), 0) + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + s.report(vx.Int() == vy.Int(), 0) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + s.report(vx.Uint() == vy.Uint(), 0) + case reflect.Float32, reflect.Float64: + s.report(vx.Float() == vy.Float(), 0) + case reflect.Complex64, reflect.Complex128: + s.report(vx.Complex() == vy.Complex(), 0) + case reflect.String: + s.report(vx.String() == vy.String(), 0) + case reflect.Chan, reflect.UnsafePointer: + s.report(vx.Pointer() == vy.Pointer(), 0) + case reflect.Func: + s.report(vx.IsNil() && vy.IsNil(), 0) + case reflect.Struct: + s.compareStruct(t, vx, vy) + case reflect.Slice, reflect.Array: + s.compareSlice(t, vx, vy) + case reflect.Map: + s.compareMap(t, vx, vy) + case reflect.Ptr: + s.comparePtr(t, vx, vy) + case reflect.Interface: + s.compareInterface(t, vx, vy) + default: + panic(fmt.Sprintf("%v kind not handled", t.Kind())) + } +} + +func (s *state) tryOptions(t reflect.Type, vx, vy reflect.Value) bool { + // Evaluate all filters and apply the remaining options. + if opt := s.opts.filter(s, t, vx, vy); opt != nil { + opt.apply(s, vx, vy) + return true + } + return false +} + +func (s *state) tryMethod(t reflect.Type, vx, vy reflect.Value) bool { + // Check if this type even has an Equal method. + m, ok := t.MethodByName("Equal") + if !ok || !function.IsType(m.Type, function.EqualAssignable) { + return false + } + + eq := s.callTTBFunc(m.Func, vx, vy) + s.report(eq, reportByMethod) + return true +} + +func (s *state) callTRFunc(f, v reflect.Value, step Transform) reflect.Value { + if !s.dynChecker.Next() { + return f.Call([]reflect.Value{v})[0] + } + + // Run the function twice and ensure that we get the same results back. + // We run in goroutines so that the race detector (if enabled) can detect + // unsafe mutations to the input. + c := make(chan reflect.Value) + go detectRaces(c, f, v) + got := <-c + want := f.Call([]reflect.Value{v})[0] + if step.vx, step.vy = got, want; !s.statelessCompare(step).Equal() { + // To avoid false-positives with non-reflexive equality operations, + // we sanity check whether a value is equal to itself. + if step.vx, step.vy = want, want; !s.statelessCompare(step).Equal() { + return want + } + panic(fmt.Sprintf("non-deterministic function detected: %s", function.NameOf(f))) + } + return want +} + +func (s *state) callTTBFunc(f, x, y reflect.Value) bool { + if !s.dynChecker.Next() { + return f.Call([]reflect.Value{x, y})[0].Bool() + } + + // Swapping the input arguments is sufficient to check that + // f is symmetric and deterministic. + // We run in goroutines so that the race detector (if enabled) can detect + // unsafe mutations to the input. + c := make(chan reflect.Value) + go detectRaces(c, f, y, x) + got := <-c + want := f.Call([]reflect.Value{x, y})[0].Bool() + if !got.IsValid() || got.Bool() != want { + panic(fmt.Sprintf("non-deterministic or non-symmetric function detected: %s", function.NameOf(f))) + } + return want +} + +func detectRaces(c chan<- reflect.Value, f reflect.Value, vs ...reflect.Value) { + var ret reflect.Value + defer func() { + recover() // Ignore panics, let the other call to f panic instead + c <- ret + }() + ret = f.Call(vs)[0] +} + +func (s *state) compareStruct(t reflect.Type, vx, vy reflect.Value) { + var addr bool + var vax, vay reflect.Value // Addressable versions of vx and vy + + var mayForce, mayForceInit bool + step := StructField{&structField{}} + for i := 0; i < t.NumField(); i++ { + step.typ = t.Field(i).Type + step.vx = vx.Field(i) + step.vy = vy.Field(i) + step.name = t.Field(i).Name + step.idx = i + step.unexported = !isExported(step.name) + if step.unexported { + if step.name == "_" { + continue + } + // Defer checking of unexported fields until later to give an + // Ignore a chance to ignore the field. + if !vax.IsValid() || !vay.IsValid() { + // For retrieveUnexportedField to work, the parent struct must + // be addressable. Create a new copy of the values if + // necessary to make them addressable. + addr = vx.CanAddr() || vy.CanAddr() + vax = makeAddressable(vx) + vay = makeAddressable(vy) + } + if !mayForceInit { + for _, xf := range s.exporters { + mayForce = mayForce || xf(t) + } + mayForceInit = true + } + step.mayForce = mayForce + step.paddr = addr + step.pvx = vax + step.pvy = vay + step.field = t.Field(i) + } + s.compareAny(step) + } +} + +func (s *state) compareSlice(t reflect.Type, vx, vy reflect.Value) { + isSlice := t.Kind() == reflect.Slice + if isSlice && (vx.IsNil() || vy.IsNil()) { + s.report(vx.IsNil() && vy.IsNil(), 0) + return + } + + // NOTE: It is incorrect to call curPtrs.Push on the slice header pointer + // since slices represents a list of pointers, rather than a single pointer. + // The pointer checking logic must be handled on a per-element basis + // in compareAny. + // + // A slice header (see reflect.SliceHeader) in Go is a tuple of a starting + // pointer P, a length N, and a capacity C. Supposing each slice element has + // a memory size of M, then the slice is equivalent to the list of pointers: + // [P+i*M for i in range(N)] + // + // For example, v[:0] and v[:1] are slices with the same starting pointer, + // but they are clearly different values. Using the slice pointer alone + // violates the assumption that equal pointers implies equal values. + + step := SliceIndex{&sliceIndex{pathStep: pathStep{typ: t.Elem()}, isSlice: isSlice}} + withIndexes := func(ix, iy int) SliceIndex { + if ix >= 0 { + step.vx, step.xkey = vx.Index(ix), ix + } else { + step.vx, step.xkey = reflect.Value{}, -1 + } + if iy >= 0 { + step.vy, step.ykey = vy.Index(iy), iy + } else { + step.vy, step.ykey = reflect.Value{}, -1 + } + return step + } + + // Ignore options are able to ignore missing elements in a slice. + // However, detecting these reliably requires an optimal differencing + // algorithm, for which diff.Difference is not. + // + // Instead, we first iterate through both slices to detect which elements + // would be ignored if standing alone. The index of non-discarded elements + // are stored in a separate slice, which diffing is then performed on. + var indexesX, indexesY []int + var ignoredX, ignoredY []bool + for ix := 0; ix < vx.Len(); ix++ { + ignored := s.statelessCompare(withIndexes(ix, -1)).NumDiff == 0 + if !ignored { + indexesX = append(indexesX, ix) + } + ignoredX = append(ignoredX, ignored) + } + for iy := 0; iy < vy.Len(); iy++ { + ignored := s.statelessCompare(withIndexes(-1, iy)).NumDiff == 0 + if !ignored { + indexesY = append(indexesY, iy) + } + ignoredY = append(ignoredY, ignored) + } + + // Compute an edit-script for slices vx and vy (excluding ignored elements). + edits := diff.Difference(len(indexesX), len(indexesY), func(ix, iy int) diff.Result { + return s.statelessCompare(withIndexes(indexesX[ix], indexesY[iy])) + }) + + // Replay the ignore-scripts and the edit-script. + var ix, iy int + for ix < vx.Len() || iy < vy.Len() { + var e diff.EditType + switch { + case ix < len(ignoredX) && ignoredX[ix]: + e = diff.UniqueX + case iy < len(ignoredY) && ignoredY[iy]: + e = diff.UniqueY + default: + e, edits = edits[0], edits[1:] + } + switch e { + case diff.UniqueX: + s.compareAny(withIndexes(ix, -1)) + ix++ + case diff.UniqueY: + s.compareAny(withIndexes(-1, iy)) + iy++ + default: + s.compareAny(withIndexes(ix, iy)) + ix++ + iy++ + } + } +} + +func (s *state) compareMap(t reflect.Type, vx, vy reflect.Value) { + if vx.IsNil() || vy.IsNil() { + s.report(vx.IsNil() && vy.IsNil(), 0) + return + } + + // Cycle-detection for maps. + if eq, visited := s.curPtrs.Push(vx, vy); visited { + s.report(eq, reportByCycle) + return + } + defer s.curPtrs.Pop(vx, vy) + + // We combine and sort the two map keys so that we can perform the + // comparisons in a deterministic order. + step := MapIndex{&mapIndex{pathStep: pathStep{typ: t.Elem()}}} + for _, k := range value.SortKeys(append(vx.MapKeys(), vy.MapKeys()...)) { + step.vx = vx.MapIndex(k) + step.vy = vy.MapIndex(k) + step.key = k + if !step.vx.IsValid() && !step.vy.IsValid() { + // It is possible for both vx and vy to be invalid if the + // key contained a NaN value in it. + // + // Even with the ability to retrieve NaN keys in Go 1.12, + // there still isn't a sensible way to compare the values since + // a NaN key may map to multiple unordered values. + // The most reasonable way to compare NaNs would be to compare the + // set of values. However, this is impossible to do efficiently + // since set equality is provably an O(n^2) operation given only + // an Equal function. If we had a Less function or Hash function, + // this could be done in O(n*log(n)) or O(n), respectively. + // + // Rather than adding complex logic to deal with NaNs, make it + // the user's responsibility to compare such obscure maps. + const help = "consider providing a Comparer to compare the map" + panic(fmt.Sprintf("%#v has map key with NaNs\n%s", s.curPath, help)) + } + s.compareAny(step) + } +} + +func (s *state) comparePtr(t reflect.Type, vx, vy reflect.Value) { + if vx.IsNil() || vy.IsNil() { + s.report(vx.IsNil() && vy.IsNil(), 0) + return + } + + // Cycle-detection for pointers. + if eq, visited := s.curPtrs.Push(vx, vy); visited { + s.report(eq, reportByCycle) + return + } + defer s.curPtrs.Pop(vx, vy) + + vx, vy = vx.Elem(), vy.Elem() + s.compareAny(Indirect{&indirect{pathStep{t.Elem(), vx, vy}}}) +} + +func (s *state) compareInterface(t reflect.Type, vx, vy reflect.Value) { + if vx.IsNil() || vy.IsNil() { + s.report(vx.IsNil() && vy.IsNil(), 0) + return + } + vx, vy = vx.Elem(), vy.Elem() + if vx.Type() != vy.Type() { + s.report(false, 0) + return + } + s.compareAny(TypeAssertion{&typeAssertion{pathStep{vx.Type(), vx, vy}}}) +} + +func (s *state) report(eq bool, rf resultFlags) { + if rf&reportByIgnore == 0 { + if eq { + s.result.NumSame++ + rf |= reportEqual + } else { + s.result.NumDiff++ + rf |= reportUnequal + } + } + for _, r := range s.reporters { + r.Report(Result{flags: rf}) + } +} + +// recChecker tracks the state needed to periodically perform checks that +// user provided transformers are not stuck in an infinitely recursive cycle. +type recChecker struct{ next int } + +// Check scans the Path for any recursive transformers and panics when any +// recursive transformers are detected. Note that the presence of a +// recursive Transformer does not necessarily imply an infinite cycle. +// As such, this check only activates after some minimal number of path steps. +func (rc *recChecker) Check(p Path) { + const minLen = 1 << 16 + if rc.next == 0 { + rc.next = minLen + } + if len(p) < rc.next { + return + } + rc.next <<= 1 + + // Check whether the same transformer has appeared at least twice. + var ss []string + m := map[Option]int{} + for _, ps := range p { + if t, ok := ps.(Transform); ok { + t := t.Option() + if m[t] == 1 { // Transformer was used exactly once before + tf := t.(*transformer).fnc.Type() + ss = append(ss, fmt.Sprintf("%v: %v => %v", t, tf.In(0), tf.Out(0))) + } + m[t]++ + } + } + if len(ss) > 0 { + const warning = "recursive set of Transformers detected" + const help = "consider using cmpopts.AcyclicTransformer" + set := strings.Join(ss, "\n\t") + panic(fmt.Sprintf("%s:\n\t%s\n%s", warning, set, help)) + } +} + +// dynChecker tracks the state needed to periodically perform checks that +// user provided functions are symmetric and deterministic. +// The zero value is safe for immediate use. +type dynChecker struct{ curr, next int } + +// Next increments the state and reports whether a check should be performed. +// +// Checks occur every Nth function call, where N is a triangular number: +// +// 0 1 3 6 10 15 21 28 36 45 55 66 78 91 105 120 136 153 171 190 ... +// +// See https://en.wikipedia.org/wiki/Triangular_number +// +// This sequence ensures that the cost of checks drops significantly as +// the number of functions calls grows larger. +func (dc *dynChecker) Next() bool { + ok := dc.curr == dc.next + if ok { + dc.curr = 0 + dc.next++ + } + dc.curr++ + return ok +} + +// makeAddressable returns a value that is always addressable. +// It returns the input verbatim if it is already addressable, +// otherwise it creates a new value and returns an addressable copy. +func makeAddressable(v reflect.Value) reflect.Value { + if v.CanAddr() { + return v + } + vc := reflect.New(v.Type()).Elem() + vc.Set(v) + return vc +} diff --git a/vendor/github.com/google/go-cmp/cmp/export.go b/vendor/github.com/google/go-cmp/cmp/export.go new file mode 100644 index 0000000..29f82fe --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/export.go @@ -0,0 +1,31 @@ +// Copyright 2017, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cmp + +import ( + "reflect" + "unsafe" +) + +// retrieveUnexportedField uses unsafe to forcibly retrieve any field from +// a struct such that the value has read-write permissions. +// +// The parent struct, v, must be addressable, while f must be a StructField +// describing the field to retrieve. If addr is false, +// then the returned value will be shallowed copied to be non-addressable. +func retrieveUnexportedField(v reflect.Value, f reflect.StructField, addr bool) reflect.Value { + ve := reflect.NewAt(f.Type, unsafe.Pointer(uintptr(unsafe.Pointer(v.UnsafeAddr()))+f.Offset)).Elem() + if !addr { + // A field is addressable if and only if the struct is addressable. + // If the original parent value was not addressable, shallow copy the + // value to make it non-addressable to avoid leaking an implementation + // detail of how forcibly exporting a field works. + if ve.Kind() == reflect.Interface && ve.IsNil() { + return reflect.Zero(f.Type) + } + return reflect.ValueOf(ve.Interface()).Convert(f.Type) + } + return ve +} diff --git a/vendor/github.com/google/go-cmp/cmp/internal/diff/debug_disable.go b/vendor/github.com/google/go-cmp/cmp/internal/diff/debug_disable.go new file mode 100644 index 0000000..36062a6 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/internal/diff/debug_disable.go @@ -0,0 +1,18 @@ +// Copyright 2017, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !cmp_debug +// +build !cmp_debug + +package diff + +var debug debugger + +type debugger struct{} + +func (debugger) Begin(_, _ int, f EqualFunc, _, _ *EditScript) EqualFunc { + return f +} +func (debugger) Update() {} +func (debugger) Finish() {} diff --git a/vendor/github.com/google/go-cmp/cmp/internal/diff/debug_enable.go b/vendor/github.com/google/go-cmp/cmp/internal/diff/debug_enable.go new file mode 100644 index 0000000..a3b97a1 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/internal/diff/debug_enable.go @@ -0,0 +1,123 @@ +// Copyright 2017, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build cmp_debug +// +build cmp_debug + +package diff + +import ( + "fmt" + "strings" + "sync" + "time" +) + +// The algorithm can be seen running in real-time by enabling debugging: +// go test -tags=cmp_debug -v +// +// Example output: +// === RUN TestDifference/#34 +// ┌───────────────────────────────┐ +// │ \ · · · · · · · · · · · · · · │ +// │ · # · · · · · · · · · · · · · │ +// │ · \ · · · · · · · · · · · · · │ +// │ · · \ · · · · · · · · · · · · │ +// │ · · · X # · · · · · · · · · · │ +// │ · · · # \ · · · · · · · · · · │ +// │ · · · · · # # · · · · · · · · │ +// │ · · · · · # \ · · · · · · · · │ +// │ · · · · · · · \ · · · · · · · │ +// │ · · · · · · · · \ · · · · · · │ +// │ · · · · · · · · · \ · · · · · │ +// │ · · · · · · · · · · \ · · # · │ +// │ · · · · · · · · · · · \ # # · │ +// │ · · · · · · · · · · · # # # · │ +// │ · · · · · · · · · · # # # # · │ +// │ · · · · · · · · · # # # # # · │ +// │ · · · · · · · · · · · · · · \ │ +// └───────────────────────────────┘ +// [.Y..M.XY......YXYXY.|] +// +// The grid represents the edit-graph where the horizontal axis represents +// list X and the vertical axis represents list Y. The start of the two lists +// is the top-left, while the ends are the bottom-right. The '·' represents +// an unexplored node in the graph. The '\' indicates that the two symbols +// from list X and Y are equal. The 'X' indicates that two symbols are similar +// (but not exactly equal) to each other. The '#' indicates that the two symbols +// are different (and not similar). The algorithm traverses this graph trying to +// make the paths starting in the top-left and the bottom-right connect. +// +// The series of '.', 'X', 'Y', and 'M' characters at the bottom represents +// the currently established path from the forward and reverse searches, +// separated by a '|' character. + +const ( + updateDelay = 100 * time.Millisecond + finishDelay = 500 * time.Millisecond + ansiTerminal = true // ANSI escape codes used to move terminal cursor +) + +var debug debugger + +type debugger struct { + sync.Mutex + p1, p2 EditScript + fwdPath, revPath *EditScript + grid []byte + lines int +} + +func (dbg *debugger) Begin(nx, ny int, f EqualFunc, p1, p2 *EditScript) EqualFunc { + dbg.Lock() + dbg.fwdPath, dbg.revPath = p1, p2 + top := "┌─" + strings.Repeat("──", nx) + "┐\n" + row := "│ " + strings.Repeat("· ", nx) + "│\n" + btm := "└─" + strings.Repeat("──", nx) + "┘\n" + dbg.grid = []byte(top + strings.Repeat(row, ny) + btm) + dbg.lines = strings.Count(dbg.String(), "\n") + fmt.Print(dbg) + + // Wrap the EqualFunc so that we can intercept each result. + return func(ix, iy int) (r Result) { + cell := dbg.grid[len(top)+iy*len(row):][len("│ ")+len("· ")*ix:][:len("·")] + for i := range cell { + cell[i] = 0 // Zero out the multiple bytes of UTF-8 middle-dot + } + switch r = f(ix, iy); { + case r.Equal(): + cell[0] = '\\' + case r.Similar(): + cell[0] = 'X' + default: + cell[0] = '#' + } + return + } +} + +func (dbg *debugger) Update() { + dbg.print(updateDelay) +} + +func (dbg *debugger) Finish() { + dbg.print(finishDelay) + dbg.Unlock() +} + +func (dbg *debugger) String() string { + dbg.p1, dbg.p2 = *dbg.fwdPath, dbg.p2[:0] + for i := len(*dbg.revPath) - 1; i >= 0; i-- { + dbg.p2 = append(dbg.p2, (*dbg.revPath)[i]) + } + return fmt.Sprintf("%s[%v|%v]\n\n", dbg.grid, dbg.p1, dbg.p2) +} + +func (dbg *debugger) print(d time.Duration) { + if ansiTerminal { + fmt.Printf("\x1b[%dA", dbg.lines) // Reset terminal cursor + } + fmt.Print(dbg) + time.Sleep(d) +} diff --git a/vendor/github.com/google/go-cmp/cmp/internal/diff/diff.go b/vendor/github.com/google/go-cmp/cmp/internal/diff/diff.go new file mode 100644 index 0000000..a248e54 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/internal/diff/diff.go @@ -0,0 +1,402 @@ +// Copyright 2017, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package diff implements an algorithm for producing edit-scripts. +// The edit-script is a sequence of operations needed to transform one list +// of symbols into another (or vice-versa). The edits allowed are insertions, +// deletions, and modifications. The summation of all edits is called the +// Levenshtein distance as this problem is well-known in computer science. +// +// This package prioritizes performance over accuracy. That is, the run time +// is more important than obtaining a minimal Levenshtein distance. +package diff + +import ( + "math/rand" + "time" + + "github.com/google/go-cmp/cmp/internal/flags" +) + +// EditType represents a single operation within an edit-script. +type EditType uint8 + +const ( + // Identity indicates that a symbol pair is identical in both list X and Y. + Identity EditType = iota + // UniqueX indicates that a symbol only exists in X and not Y. + UniqueX + // UniqueY indicates that a symbol only exists in Y and not X. + UniqueY + // Modified indicates that a symbol pair is a modification of each other. + Modified +) + +// EditScript represents the series of differences between two lists. +type EditScript []EditType + +// String returns a human-readable string representing the edit-script where +// Identity, UniqueX, UniqueY, and Modified are represented by the +// '.', 'X', 'Y', and 'M' characters, respectively. +func (es EditScript) String() string { + b := make([]byte, len(es)) + for i, e := range es { + switch e { + case Identity: + b[i] = '.' + case UniqueX: + b[i] = 'X' + case UniqueY: + b[i] = 'Y' + case Modified: + b[i] = 'M' + default: + panic("invalid edit-type") + } + } + return string(b) +} + +// stats returns a histogram of the number of each type of edit operation. +func (es EditScript) stats() (s struct{ NI, NX, NY, NM int }) { + for _, e := range es { + switch e { + case Identity: + s.NI++ + case UniqueX: + s.NX++ + case UniqueY: + s.NY++ + case Modified: + s.NM++ + default: + panic("invalid edit-type") + } + } + return +} + +// Dist is the Levenshtein distance and is guaranteed to be 0 if and only if +// lists X and Y are equal. +func (es EditScript) Dist() int { return len(es) - es.stats().NI } + +// LenX is the length of the X list. +func (es EditScript) LenX() int { return len(es) - es.stats().NY } + +// LenY is the length of the Y list. +func (es EditScript) LenY() int { return len(es) - es.stats().NX } + +// EqualFunc reports whether the symbols at indexes ix and iy are equal. +// When called by Difference, the index is guaranteed to be within nx and ny. +type EqualFunc func(ix int, iy int) Result + +// Result is the result of comparison. +// NumSame is the number of sub-elements that are equal. +// NumDiff is the number of sub-elements that are not equal. +type Result struct{ NumSame, NumDiff int } + +// BoolResult returns a Result that is either Equal or not Equal. +func BoolResult(b bool) Result { + if b { + return Result{NumSame: 1} // Equal, Similar + } else { + return Result{NumDiff: 2} // Not Equal, not Similar + } +} + +// Equal indicates whether the symbols are equal. Two symbols are equal +// if and only if NumDiff == 0. If Equal, then they are also Similar. +func (r Result) Equal() bool { return r.NumDiff == 0 } + +// Similar indicates whether two symbols are similar and may be represented +// by using the Modified type. As a special case, we consider binary comparisons +// (i.e., those that return Result{1, 0} or Result{0, 1}) to be similar. +// +// The exact ratio of NumSame to NumDiff to determine similarity may change. +func (r Result) Similar() bool { + // Use NumSame+1 to offset NumSame so that binary comparisons are similar. + return r.NumSame+1 >= r.NumDiff +} + +var randBool = rand.New(rand.NewSource(time.Now().Unix())).Intn(2) == 0 + +// Difference reports whether two lists of lengths nx and ny are equal +// given the definition of equality provided as f. +// +// This function returns an edit-script, which is a sequence of operations +// needed to convert one list into the other. The following invariants for +// the edit-script are maintained: +// - eq == (es.Dist()==0) +// - nx == es.LenX() +// - ny == es.LenY() +// +// This algorithm is not guaranteed to be an optimal solution (i.e., one that +// produces an edit-script with a minimal Levenshtein distance). This algorithm +// favors performance over optimality. The exact output is not guaranteed to +// be stable and may change over time. +func Difference(nx, ny int, f EqualFunc) (es EditScript) { + // This algorithm is based on traversing what is known as an "edit-graph". + // See Figure 1 from "An O(ND) Difference Algorithm and Its Variations" + // by Eugene W. Myers. Since D can be as large as N itself, this is + // effectively O(N^2). Unlike the algorithm from that paper, we are not + // interested in the optimal path, but at least some "decent" path. + // + // For example, let X and Y be lists of symbols: + // X = [A B C A B B A] + // Y = [C B A B A C] + // + // The edit-graph can be drawn as the following: + // A B C A B B A + // ┌─────────────┐ + // C │_|_|\|_|_|_|_│ 0 + // B │_|\|_|_|\|\|_│ 1 + // A │\|_|_|\|_|_|\│ 2 + // B │_|\|_|_|\|\|_│ 3 + // A │\|_|_|\|_|_|\│ 4 + // C │ | |\| | | | │ 5 + // └─────────────┘ 6 + // 0 1 2 3 4 5 6 7 + // + // List X is written along the horizontal axis, while list Y is written + // along the vertical axis. At any point on this grid, if the symbol in + // list X matches the corresponding symbol in list Y, then a '\' is drawn. + // The goal of any minimal edit-script algorithm is to find a path from the + // top-left corner to the bottom-right corner, while traveling through the + // fewest horizontal or vertical edges. + // A horizontal edge is equivalent to inserting a symbol from list X. + // A vertical edge is equivalent to inserting a symbol from list Y. + // A diagonal edge is equivalent to a matching symbol between both X and Y. + + // Invariants: + // - 0 ≤ fwdPath.X ≤ (fwdFrontier.X, revFrontier.X) ≤ revPath.X ≤ nx + // - 0 ≤ fwdPath.Y ≤ (fwdFrontier.Y, revFrontier.Y) ≤ revPath.Y ≤ ny + // + // In general: + // - fwdFrontier.X < revFrontier.X + // - fwdFrontier.Y < revFrontier.Y + // + // Unless, it is time for the algorithm to terminate. + fwdPath := path{+1, point{0, 0}, make(EditScript, 0, (nx+ny)/2)} + revPath := path{-1, point{nx, ny}, make(EditScript, 0)} + fwdFrontier := fwdPath.point // Forward search frontier + revFrontier := revPath.point // Reverse search frontier + + // Search budget bounds the cost of searching for better paths. + // The longest sequence of non-matching symbols that can be tolerated is + // approximately the square-root of the search budget. + searchBudget := 4 * (nx + ny) // O(n) + + // Running the tests with the "cmp_debug" build tag prints a visualization + // of the algorithm running in real-time. This is educational for + // understanding how the algorithm works. See debug_enable.go. + f = debug.Begin(nx, ny, f, &fwdPath.es, &revPath.es) + + // The algorithm below is a greedy, meet-in-the-middle algorithm for + // computing sub-optimal edit-scripts between two lists. + // + // The algorithm is approximately as follows: + // - Searching for differences switches back-and-forth between + // a search that starts at the beginning (the top-left corner), and + // a search that starts at the end (the bottom-right corner). + // The goal of the search is connect with the search + // from the opposite corner. + // - As we search, we build a path in a greedy manner, + // where the first match seen is added to the path (this is sub-optimal, + // but provides a decent result in practice). When matches are found, + // we try the next pair of symbols in the lists and follow all matches + // as far as possible. + // - When searching for matches, we search along a diagonal going through + // through the "frontier" point. If no matches are found, + // we advance the frontier towards the opposite corner. + // - This algorithm terminates when either the X coordinates or the + // Y coordinates of the forward and reverse frontier points ever intersect. + + // This algorithm is correct even if searching only in the forward direction + // or in the reverse direction. We do both because it is commonly observed + // that two lists commonly differ because elements were added to the front + // or end of the other list. + // + // Non-deterministically start with either the forward or reverse direction + // to introduce some deliberate instability so that we have the flexibility + // to change this algorithm in the future. + if flags.Deterministic || randBool { + goto forwardSearch + } else { + goto reverseSearch + } + +forwardSearch: + { + // Forward search from the beginning. + if fwdFrontier.X >= revFrontier.X || fwdFrontier.Y >= revFrontier.Y || searchBudget == 0 { + goto finishSearch + } + for stop1, stop2, i := false, false, 0; !(stop1 && stop2) && searchBudget > 0; i++ { + // Search in a diagonal pattern for a match. + z := zigzag(i) + p := point{fwdFrontier.X + z, fwdFrontier.Y - z} + switch { + case p.X >= revPath.X || p.Y < fwdPath.Y: + stop1 = true // Hit top-right corner + case p.Y >= revPath.Y || p.X < fwdPath.X: + stop2 = true // Hit bottom-left corner + case f(p.X, p.Y).Equal(): + // Match found, so connect the path to this point. + fwdPath.connect(p, f) + fwdPath.append(Identity) + // Follow sequence of matches as far as possible. + for fwdPath.X < revPath.X && fwdPath.Y < revPath.Y { + if !f(fwdPath.X, fwdPath.Y).Equal() { + break + } + fwdPath.append(Identity) + } + fwdFrontier = fwdPath.point + stop1, stop2 = true, true + default: + searchBudget-- // Match not found + } + debug.Update() + } + // Advance the frontier towards reverse point. + if revPath.X-fwdFrontier.X >= revPath.Y-fwdFrontier.Y { + fwdFrontier.X++ + } else { + fwdFrontier.Y++ + } + goto reverseSearch + } + +reverseSearch: + { + // Reverse search from the end. + if fwdFrontier.X >= revFrontier.X || fwdFrontier.Y >= revFrontier.Y || searchBudget == 0 { + goto finishSearch + } + for stop1, stop2, i := false, false, 0; !(stop1 && stop2) && searchBudget > 0; i++ { + // Search in a diagonal pattern for a match. + z := zigzag(i) + p := point{revFrontier.X - z, revFrontier.Y + z} + switch { + case fwdPath.X >= p.X || revPath.Y < p.Y: + stop1 = true // Hit bottom-left corner + case fwdPath.Y >= p.Y || revPath.X < p.X: + stop2 = true // Hit top-right corner + case f(p.X-1, p.Y-1).Equal(): + // Match found, so connect the path to this point. + revPath.connect(p, f) + revPath.append(Identity) + // Follow sequence of matches as far as possible. + for fwdPath.X < revPath.X && fwdPath.Y < revPath.Y { + if !f(revPath.X-1, revPath.Y-1).Equal() { + break + } + revPath.append(Identity) + } + revFrontier = revPath.point + stop1, stop2 = true, true + default: + searchBudget-- // Match not found + } + debug.Update() + } + // Advance the frontier towards forward point. + if revFrontier.X-fwdPath.X >= revFrontier.Y-fwdPath.Y { + revFrontier.X-- + } else { + revFrontier.Y-- + } + goto forwardSearch + } + +finishSearch: + // Join the forward and reverse paths and then append the reverse path. + fwdPath.connect(revPath.point, f) + for i := len(revPath.es) - 1; i >= 0; i-- { + t := revPath.es[i] + revPath.es = revPath.es[:i] + fwdPath.append(t) + } + debug.Finish() + return fwdPath.es +} + +type path struct { + dir int // +1 if forward, -1 if reverse + point // Leading point of the EditScript path + es EditScript +} + +// connect appends any necessary Identity, Modified, UniqueX, or UniqueY types +// to the edit-script to connect p.point to dst. +func (p *path) connect(dst point, f EqualFunc) { + if p.dir > 0 { + // Connect in forward direction. + for dst.X > p.X && dst.Y > p.Y { + switch r := f(p.X, p.Y); { + case r.Equal(): + p.append(Identity) + case r.Similar(): + p.append(Modified) + case dst.X-p.X >= dst.Y-p.Y: + p.append(UniqueX) + default: + p.append(UniqueY) + } + } + for dst.X > p.X { + p.append(UniqueX) + } + for dst.Y > p.Y { + p.append(UniqueY) + } + } else { + // Connect in reverse direction. + for p.X > dst.X && p.Y > dst.Y { + switch r := f(p.X-1, p.Y-1); { + case r.Equal(): + p.append(Identity) + case r.Similar(): + p.append(Modified) + case p.Y-dst.Y >= p.X-dst.X: + p.append(UniqueY) + default: + p.append(UniqueX) + } + } + for p.X > dst.X { + p.append(UniqueX) + } + for p.Y > dst.Y { + p.append(UniqueY) + } + } +} + +func (p *path) append(t EditType) { + p.es = append(p.es, t) + switch t { + case Identity, Modified: + p.add(p.dir, p.dir) + case UniqueX: + p.add(p.dir, 0) + case UniqueY: + p.add(0, p.dir) + } + debug.Update() +} + +type point struct{ X, Y int } + +func (p *point) add(dx, dy int) { p.X += dx; p.Y += dy } + +// zigzag maps a consecutive sequence of integers to a zig-zag sequence. +// +// [0 1 2 3 4 5 ...] => [0 -1 +1 -2 +2 ...] +func zigzag(x int) int { + if x&1 != 0 { + x = ^x + } + return x >> 1 +} diff --git a/vendor/github.com/google/go-cmp/cmp/internal/flags/flags.go b/vendor/github.com/google/go-cmp/cmp/internal/flags/flags.go new file mode 100644 index 0000000..d8e459c --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/internal/flags/flags.go @@ -0,0 +1,9 @@ +// Copyright 2019, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package flags + +// Deterministic controls whether the output of Diff should be deterministic. +// This is only used for testing. +var Deterministic bool diff --git a/vendor/github.com/google/go-cmp/cmp/internal/function/func.go b/vendor/github.com/google/go-cmp/cmp/internal/function/func.go new file mode 100644 index 0000000..d127d43 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/internal/function/func.go @@ -0,0 +1,99 @@ +// Copyright 2017, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package function provides functionality for identifying function types. +package function + +import ( + "reflect" + "regexp" + "runtime" + "strings" +) + +type funcType int + +const ( + _ funcType = iota + + tbFunc // func(T) bool + ttbFunc // func(T, T) bool + trbFunc // func(T, R) bool + tibFunc // func(T, I) bool + trFunc // func(T) R + + Equal = ttbFunc // func(T, T) bool + EqualAssignable = tibFunc // func(T, I) bool; encapsulates func(T, T) bool + Transformer = trFunc // func(T) R + ValueFilter = ttbFunc // func(T, T) bool + Less = ttbFunc // func(T, T) bool + ValuePredicate = tbFunc // func(T) bool + KeyValuePredicate = trbFunc // func(T, R) bool +) + +var boolType = reflect.TypeOf(true) + +// IsType reports whether the reflect.Type is of the specified function type. +func IsType(t reflect.Type, ft funcType) bool { + if t == nil || t.Kind() != reflect.Func || t.IsVariadic() { + return false + } + ni, no := t.NumIn(), t.NumOut() + switch ft { + case tbFunc: // func(T) bool + if ni == 1 && no == 1 && t.Out(0) == boolType { + return true + } + case ttbFunc: // func(T, T) bool + if ni == 2 && no == 1 && t.In(0) == t.In(1) && t.Out(0) == boolType { + return true + } + case trbFunc: // func(T, R) bool + if ni == 2 && no == 1 && t.Out(0) == boolType { + return true + } + case tibFunc: // func(T, I) bool + if ni == 2 && no == 1 && t.In(0).AssignableTo(t.In(1)) && t.Out(0) == boolType { + return true + } + case trFunc: // func(T) R + if ni == 1 && no == 1 { + return true + } + } + return false +} + +var lastIdentRx = regexp.MustCompile(`[_\p{L}][_\p{L}\p{N}]*$`) + +// NameOf returns the name of the function value. +func NameOf(v reflect.Value) string { + fnc := runtime.FuncForPC(v.Pointer()) + if fnc == nil { + return "" + } + fullName := fnc.Name() // e.g., "long/path/name/mypkg.(*MyType).(long/path/name/mypkg.myMethod)-fm" + + // Method closures have a "-fm" suffix. + fullName = strings.TrimSuffix(fullName, "-fm") + + var name string + for len(fullName) > 0 { + inParen := strings.HasSuffix(fullName, ")") + fullName = strings.TrimSuffix(fullName, ")") + + s := lastIdentRx.FindString(fullName) + if s == "" { + break + } + name = s + "." + name + fullName = strings.TrimSuffix(fullName, s) + + if i := strings.LastIndexByte(fullName, '('); inParen && i >= 0 { + fullName = fullName[:i] + } + fullName = strings.TrimSuffix(fullName, ".") + } + return strings.TrimSuffix(name, ".") +} diff --git a/vendor/github.com/google/go-cmp/cmp/internal/value/name.go b/vendor/github.com/google/go-cmp/cmp/internal/value/name.go new file mode 100644 index 0000000..7b498bb --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/internal/value/name.go @@ -0,0 +1,164 @@ +// Copyright 2020, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package value + +import ( + "reflect" + "strconv" +) + +var anyType = reflect.TypeOf((*interface{})(nil)).Elem() + +// TypeString is nearly identical to reflect.Type.String, +// but has an additional option to specify that full type names be used. +func TypeString(t reflect.Type, qualified bool) string { + return string(appendTypeName(nil, t, qualified, false)) +} + +func appendTypeName(b []byte, t reflect.Type, qualified, elideFunc bool) []byte { + // BUG: Go reflection provides no way to disambiguate two named types + // of the same name and within the same package, + // but declared within the namespace of different functions. + + // Use the "any" alias instead of "interface{}" for better readability. + if t == anyType { + return append(b, "any"...) + } + + // Named type. + if t.Name() != "" { + if qualified && t.PkgPath() != "" { + b = append(b, '"') + b = append(b, t.PkgPath()...) + b = append(b, '"') + b = append(b, '.') + b = append(b, t.Name()...) + } else { + b = append(b, t.String()...) + } + return b + } + + // Unnamed type. + switch k := t.Kind(); k { + case reflect.Bool, reflect.String, reflect.UnsafePointer, + reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64, + reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr, + reflect.Float32, reflect.Float64, reflect.Complex64, reflect.Complex128: + b = append(b, k.String()...) + case reflect.Chan: + if t.ChanDir() == reflect.RecvDir { + b = append(b, "<-"...) + } + b = append(b, "chan"...) + if t.ChanDir() == reflect.SendDir { + b = append(b, "<-"...) + } + b = append(b, ' ') + b = appendTypeName(b, t.Elem(), qualified, false) + case reflect.Func: + if !elideFunc { + b = append(b, "func"...) + } + b = append(b, '(') + for i := 0; i < t.NumIn(); i++ { + if i > 0 { + b = append(b, ", "...) + } + if i == t.NumIn()-1 && t.IsVariadic() { + b = append(b, "..."...) + b = appendTypeName(b, t.In(i).Elem(), qualified, false) + } else { + b = appendTypeName(b, t.In(i), qualified, false) + } + } + b = append(b, ')') + switch t.NumOut() { + case 0: + // Do nothing + case 1: + b = append(b, ' ') + b = appendTypeName(b, t.Out(0), qualified, false) + default: + b = append(b, " ("...) + for i := 0; i < t.NumOut(); i++ { + if i > 0 { + b = append(b, ", "...) + } + b = appendTypeName(b, t.Out(i), qualified, false) + } + b = append(b, ')') + } + case reflect.Struct: + b = append(b, "struct{ "...) + for i := 0; i < t.NumField(); i++ { + if i > 0 { + b = append(b, "; "...) + } + sf := t.Field(i) + if !sf.Anonymous { + if qualified && sf.PkgPath != "" { + b = append(b, '"') + b = append(b, sf.PkgPath...) + b = append(b, '"') + b = append(b, '.') + } + b = append(b, sf.Name...) + b = append(b, ' ') + } + b = appendTypeName(b, sf.Type, qualified, false) + if sf.Tag != "" { + b = append(b, ' ') + b = strconv.AppendQuote(b, string(sf.Tag)) + } + } + if b[len(b)-1] == ' ' { + b = b[:len(b)-1] + } else { + b = append(b, ' ') + } + b = append(b, '}') + case reflect.Slice, reflect.Array: + b = append(b, '[') + if k == reflect.Array { + b = strconv.AppendUint(b, uint64(t.Len()), 10) + } + b = append(b, ']') + b = appendTypeName(b, t.Elem(), qualified, false) + case reflect.Map: + b = append(b, "map["...) + b = appendTypeName(b, t.Key(), qualified, false) + b = append(b, ']') + b = appendTypeName(b, t.Elem(), qualified, false) + case reflect.Ptr: + b = append(b, '*') + b = appendTypeName(b, t.Elem(), qualified, false) + case reflect.Interface: + b = append(b, "interface{ "...) + for i := 0; i < t.NumMethod(); i++ { + if i > 0 { + b = append(b, "; "...) + } + m := t.Method(i) + if qualified && m.PkgPath != "" { + b = append(b, '"') + b = append(b, m.PkgPath...) + b = append(b, '"') + b = append(b, '.') + } + b = append(b, m.Name...) + b = appendTypeName(b, m.Type, qualified, true) + } + if b[len(b)-1] == ' ' { + b = b[:len(b)-1] + } else { + b = append(b, ' ') + } + b = append(b, '}') + default: + panic("invalid kind: " + k.String()) + } + return b +} diff --git a/vendor/github.com/google/go-cmp/cmp/internal/value/pointer.go b/vendor/github.com/google/go-cmp/cmp/internal/value/pointer.go new file mode 100644 index 0000000..e5dfff6 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/internal/value/pointer.go @@ -0,0 +1,34 @@ +// Copyright 2018, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package value + +import ( + "reflect" + "unsafe" +) + +// Pointer is an opaque typed pointer and is guaranteed to be comparable. +type Pointer struct { + p unsafe.Pointer + t reflect.Type +} + +// PointerOf returns a Pointer from v, which must be a +// reflect.Ptr, reflect.Slice, or reflect.Map. +func PointerOf(v reflect.Value) Pointer { + // The proper representation of a pointer is unsafe.Pointer, + // which is necessary if the GC ever uses a moving collector. + return Pointer{unsafe.Pointer(v.Pointer()), v.Type()} +} + +// IsNil reports whether the pointer is nil. +func (p Pointer) IsNil() bool { + return p.p == nil +} + +// Uintptr returns the pointer as a uintptr. +func (p Pointer) Uintptr() uintptr { + return uintptr(p.p) +} diff --git a/vendor/github.com/google/go-cmp/cmp/internal/value/sort.go b/vendor/github.com/google/go-cmp/cmp/internal/value/sort.go new file mode 100644 index 0000000..98533b0 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/internal/value/sort.go @@ -0,0 +1,106 @@ +// Copyright 2017, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package value + +import ( + "fmt" + "math" + "reflect" + "sort" +) + +// SortKeys sorts a list of map keys, deduplicating keys if necessary. +// The type of each value must be comparable. +func SortKeys(vs []reflect.Value) []reflect.Value { + if len(vs) == 0 { + return vs + } + + // Sort the map keys. + sort.SliceStable(vs, func(i, j int) bool { return isLess(vs[i], vs[j]) }) + + // Deduplicate keys (fails for NaNs). + vs2 := vs[:1] + for _, v := range vs[1:] { + if isLess(vs2[len(vs2)-1], v) { + vs2 = append(vs2, v) + } + } + return vs2 +} + +// isLess is a generic function for sorting arbitrary map keys. +// The inputs must be of the same type and must be comparable. +func isLess(x, y reflect.Value) bool { + switch x.Type().Kind() { + case reflect.Bool: + return !x.Bool() && y.Bool() + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return x.Int() < y.Int() + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return x.Uint() < y.Uint() + case reflect.Float32, reflect.Float64: + // NOTE: This does not sort -0 as less than +0 + // since Go maps treat -0 and +0 as equal keys. + fx, fy := x.Float(), y.Float() + return fx < fy || math.IsNaN(fx) && !math.IsNaN(fy) + case reflect.Complex64, reflect.Complex128: + cx, cy := x.Complex(), y.Complex() + rx, ix, ry, iy := real(cx), imag(cx), real(cy), imag(cy) + if rx == ry || (math.IsNaN(rx) && math.IsNaN(ry)) { + return ix < iy || math.IsNaN(ix) && !math.IsNaN(iy) + } + return rx < ry || math.IsNaN(rx) && !math.IsNaN(ry) + case reflect.Ptr, reflect.UnsafePointer, reflect.Chan: + return x.Pointer() < y.Pointer() + case reflect.String: + return x.String() < y.String() + case reflect.Array: + for i := 0; i < x.Len(); i++ { + if isLess(x.Index(i), y.Index(i)) { + return true + } + if isLess(y.Index(i), x.Index(i)) { + return false + } + } + return false + case reflect.Struct: + for i := 0; i < x.NumField(); i++ { + if isLess(x.Field(i), y.Field(i)) { + return true + } + if isLess(y.Field(i), x.Field(i)) { + return false + } + } + return false + case reflect.Interface: + vx, vy := x.Elem(), y.Elem() + if !vx.IsValid() || !vy.IsValid() { + return !vx.IsValid() && vy.IsValid() + } + tx, ty := vx.Type(), vy.Type() + if tx == ty { + return isLess(x.Elem(), y.Elem()) + } + if tx.Kind() != ty.Kind() { + return vx.Kind() < vy.Kind() + } + if tx.String() != ty.String() { + return tx.String() < ty.String() + } + if tx.PkgPath() != ty.PkgPath() { + return tx.PkgPath() < ty.PkgPath() + } + // This can happen in rare situations, so we fallback to just comparing + // the unique pointer for a reflect.Type. This guarantees deterministic + // ordering within a program, but it is obviously not stable. + return reflect.ValueOf(vx.Type()).Pointer() < reflect.ValueOf(vy.Type()).Pointer() + default: + // Must be Func, Map, or Slice; which are not comparable. + panic(fmt.Sprintf("%T is not comparable", x.Type())) + } +} diff --git a/vendor/github.com/google/go-cmp/cmp/options.go b/vendor/github.com/google/go-cmp/cmp/options.go new file mode 100644 index 0000000..754496f --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/options.go @@ -0,0 +1,554 @@ +// Copyright 2017, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cmp + +import ( + "fmt" + "reflect" + "regexp" + "strings" + + "github.com/google/go-cmp/cmp/internal/function" +) + +// Option configures for specific behavior of [Equal] and [Diff]. In particular, +// the fundamental Option functions ([Ignore], [Transformer], and [Comparer]), +// configure how equality is determined. +// +// The fundamental options may be composed with filters ([FilterPath] and +// [FilterValues]) to control the scope over which they are applied. +// +// The [github.com/google/go-cmp/cmp/cmpopts] package provides helper functions +// for creating options that may be used with [Equal] and [Diff]. +type Option interface { + // filter applies all filters and returns the option that remains. + // Each option may only read s.curPath and call s.callTTBFunc. + // + // An Options is returned only if multiple comparers or transformers + // can apply simultaneously and will only contain values of those types + // or sub-Options containing values of those types. + filter(s *state, t reflect.Type, vx, vy reflect.Value) applicableOption +} + +// applicableOption represents the following types: +// +// Fundamental: ignore | validator | *comparer | *transformer +// Grouping: Options +type applicableOption interface { + Option + + // apply executes the option, which may mutate s or panic. + apply(s *state, vx, vy reflect.Value) +} + +// coreOption represents the following types: +// +// Fundamental: ignore | validator | *comparer | *transformer +// Filters: *pathFilter | *valuesFilter +type coreOption interface { + Option + isCore() +} + +type core struct{} + +func (core) isCore() {} + +// Options is a list of [Option] values that also satisfies the [Option] interface. +// Helper comparison packages may return an Options value when packing multiple +// [Option] values into a single [Option]. When this package processes an Options, +// it will be implicitly expanded into a flat list. +// +// Applying a filter on an Options is equivalent to applying that same filter +// on all individual options held within. +type Options []Option + +func (opts Options) filter(s *state, t reflect.Type, vx, vy reflect.Value) (out applicableOption) { + for _, opt := range opts { + switch opt := opt.filter(s, t, vx, vy); opt.(type) { + case ignore: + return ignore{} // Only ignore can short-circuit evaluation + case validator: + out = validator{} // Takes precedence over comparer or transformer + case *comparer, *transformer, Options: + switch out.(type) { + case nil: + out = opt + case validator: + // Keep validator + case *comparer, *transformer, Options: + out = Options{out, opt} // Conflicting comparers or transformers + } + } + } + return out +} + +func (opts Options) apply(s *state, _, _ reflect.Value) { + const warning = "ambiguous set of applicable options" + const help = "consider using filters to ensure at most one Comparer or Transformer may apply" + var ss []string + for _, opt := range flattenOptions(nil, opts) { + ss = append(ss, fmt.Sprint(opt)) + } + set := strings.Join(ss, "\n\t") + panic(fmt.Sprintf("%s at %#v:\n\t%s\n%s", warning, s.curPath, set, help)) +} + +func (opts Options) String() string { + var ss []string + for _, opt := range opts { + ss = append(ss, fmt.Sprint(opt)) + } + return fmt.Sprintf("Options{%s}", strings.Join(ss, ", ")) +} + +// FilterPath returns a new [Option] where opt is only evaluated if filter f +// returns true for the current [Path] in the value tree. +// +// This filter is called even if a slice element or map entry is missing and +// provides an opportunity to ignore such cases. The filter function must be +// symmetric such that the filter result is identical regardless of whether the +// missing value is from x or y. +// +// The option passed in may be an [Ignore], [Transformer], [Comparer], [Options], or +// a previously filtered [Option]. +func FilterPath(f func(Path) bool, opt Option) Option { + if f == nil { + panic("invalid path filter function") + } + if opt := normalizeOption(opt); opt != nil { + return &pathFilter{fnc: f, opt: opt} + } + return nil +} + +type pathFilter struct { + core + fnc func(Path) bool + opt Option +} + +func (f pathFilter) filter(s *state, t reflect.Type, vx, vy reflect.Value) applicableOption { + if f.fnc(s.curPath) { + return f.opt.filter(s, t, vx, vy) + } + return nil +} + +func (f pathFilter) String() string { + return fmt.Sprintf("FilterPath(%s, %v)", function.NameOf(reflect.ValueOf(f.fnc)), f.opt) +} + +// FilterValues returns a new [Option] where opt is only evaluated if filter f, +// which is a function of the form "func(T, T) bool", returns true for the +// current pair of values being compared. If either value is invalid or +// the type of the values is not assignable to T, then this filter implicitly +// returns false. +// +// The filter function must be +// symmetric (i.e., agnostic to the order of the inputs) and +// deterministic (i.e., produces the same result when given the same inputs). +// If T is an interface, it is possible that f is called with two values with +// different concrete types that both implement T. +// +// The option passed in may be an [Ignore], [Transformer], [Comparer], [Options], or +// a previously filtered [Option]. +func FilterValues(f interface{}, opt Option) Option { + v := reflect.ValueOf(f) + if !function.IsType(v.Type(), function.ValueFilter) || v.IsNil() { + panic(fmt.Sprintf("invalid values filter function: %T", f)) + } + if opt := normalizeOption(opt); opt != nil { + vf := &valuesFilter{fnc: v, opt: opt} + if ti := v.Type().In(0); ti.Kind() != reflect.Interface || ti.NumMethod() > 0 { + vf.typ = ti + } + return vf + } + return nil +} + +type valuesFilter struct { + core + typ reflect.Type // T + fnc reflect.Value // func(T, T) bool + opt Option +} + +func (f valuesFilter) filter(s *state, t reflect.Type, vx, vy reflect.Value) applicableOption { + if !vx.IsValid() || !vx.CanInterface() || !vy.IsValid() || !vy.CanInterface() { + return nil + } + if (f.typ == nil || t.AssignableTo(f.typ)) && s.callTTBFunc(f.fnc, vx, vy) { + return f.opt.filter(s, t, vx, vy) + } + return nil +} + +func (f valuesFilter) String() string { + return fmt.Sprintf("FilterValues(%s, %v)", function.NameOf(f.fnc), f.opt) +} + +// Ignore is an [Option] that causes all comparisons to be ignored. +// This value is intended to be combined with [FilterPath] or [FilterValues]. +// It is an error to pass an unfiltered Ignore option to [Equal]. +func Ignore() Option { return ignore{} } + +type ignore struct{ core } + +func (ignore) isFiltered() bool { return false } +func (ignore) filter(_ *state, _ reflect.Type, _, _ reflect.Value) applicableOption { return ignore{} } +func (ignore) apply(s *state, _, _ reflect.Value) { s.report(true, reportByIgnore) } +func (ignore) String() string { return "Ignore()" } + +// validator is a sentinel Option type to indicate that some options could not +// be evaluated due to unexported fields, missing slice elements, or +// missing map entries. Both values are validator only for unexported fields. +type validator struct{ core } + +func (validator) filter(_ *state, _ reflect.Type, vx, vy reflect.Value) applicableOption { + if !vx.IsValid() || !vy.IsValid() { + return validator{} + } + if !vx.CanInterface() || !vy.CanInterface() { + return validator{} + } + return nil +} +func (validator) apply(s *state, vx, vy reflect.Value) { + // Implies missing slice element or map entry. + if !vx.IsValid() || !vy.IsValid() { + s.report(vx.IsValid() == vy.IsValid(), 0) + return + } + + // Unable to Interface implies unexported field without visibility access. + if !vx.CanInterface() || !vy.CanInterface() { + help := "consider using a custom Comparer; if you control the implementation of type, you can also consider using an Exporter, AllowUnexported, or cmpopts.IgnoreUnexported" + var name string + if t := s.curPath.Index(-2).Type(); t.Name() != "" { + // Named type with unexported fields. + name = fmt.Sprintf("%q.%v", t.PkgPath(), t.Name()) // e.g., "path/to/package".MyType + if _, ok := reflect.New(t).Interface().(error); ok { + help = "consider using cmpopts.EquateErrors to compare error values" + } else if t.Comparable() { + help = "consider using cmpopts.EquateComparable to compare comparable Go types" + } + } else { + // Unnamed type with unexported fields. Derive PkgPath from field. + var pkgPath string + for i := 0; i < t.NumField() && pkgPath == ""; i++ { + pkgPath = t.Field(i).PkgPath + } + name = fmt.Sprintf("%q.(%v)", pkgPath, t.String()) // e.g., "path/to/package".(struct { a int }) + } + panic(fmt.Sprintf("cannot handle unexported field at %#v:\n\t%v\n%s", s.curPath, name, help)) + } + + panic("not reachable") +} + +// identRx represents a valid identifier according to the Go specification. +const identRx = `[_\p{L}][_\p{L}\p{N}]*` + +var identsRx = regexp.MustCompile(`^` + identRx + `(\.` + identRx + `)*$`) + +// Transformer returns an [Option] that applies a transformation function that +// converts values of a certain type into that of another. +// +// The transformer f must be a function "func(T) R" that converts values of +// type T to those of type R and is implicitly filtered to input values +// assignable to T. The transformer must not mutate T in any way. +// +// To help prevent some cases of infinite recursive cycles applying the +// same transform to the output of itself (e.g., in the case where the +// input and output types are the same), an implicit filter is added such that +// a transformer is applicable only if that exact transformer is not already +// in the tail of the [Path] since the last non-[Transform] step. +// For situations where the implicit filter is still insufficient, +// consider using [github.com/google/go-cmp/cmp/cmpopts.AcyclicTransformer], +// which adds a filter to prevent the transformer from +// being recursively applied upon itself. +// +// The name is a user provided label that is used as the [Transform.Name] in the +// transformation [PathStep] (and eventually shown in the [Diff] output). +// The name must be a valid identifier or qualified identifier in Go syntax. +// If empty, an arbitrary name is used. +func Transformer(name string, f interface{}) Option { + v := reflect.ValueOf(f) + if !function.IsType(v.Type(), function.Transformer) || v.IsNil() { + panic(fmt.Sprintf("invalid transformer function: %T", f)) + } + if name == "" { + name = function.NameOf(v) + if !identsRx.MatchString(name) { + name = "λ" // Lambda-symbol as placeholder name + } + } else if !identsRx.MatchString(name) { + panic(fmt.Sprintf("invalid name: %q", name)) + } + tr := &transformer{name: name, fnc: reflect.ValueOf(f)} + if ti := v.Type().In(0); ti.Kind() != reflect.Interface || ti.NumMethod() > 0 { + tr.typ = ti + } + return tr +} + +type transformer struct { + core + name string + typ reflect.Type // T + fnc reflect.Value // func(T) R +} + +func (tr *transformer) isFiltered() bool { return tr.typ != nil } + +func (tr *transformer) filter(s *state, t reflect.Type, _, _ reflect.Value) applicableOption { + for i := len(s.curPath) - 1; i >= 0; i-- { + if t, ok := s.curPath[i].(Transform); !ok { + break // Hit most recent non-Transform step + } else if tr == t.trans { + return nil // Cannot directly use same Transform + } + } + if tr.typ == nil || t.AssignableTo(tr.typ) { + return tr + } + return nil +} + +func (tr *transformer) apply(s *state, vx, vy reflect.Value) { + step := Transform{&transform{pathStep{typ: tr.fnc.Type().Out(0)}, tr}} + vvx := s.callTRFunc(tr.fnc, vx, step) + vvy := s.callTRFunc(tr.fnc, vy, step) + step.vx, step.vy = vvx, vvy + s.compareAny(step) +} + +func (tr transformer) String() string { + return fmt.Sprintf("Transformer(%s, %s)", tr.name, function.NameOf(tr.fnc)) +} + +// Comparer returns an [Option] that determines whether two values are equal +// to each other. +// +// The comparer f must be a function "func(T, T) bool" and is implicitly +// filtered to input values assignable to T. If T is an interface, it is +// possible that f is called with two values of different concrete types that +// both implement T. +// +// The equality function must be: +// - Symmetric: equal(x, y) == equal(y, x) +// - Deterministic: equal(x, y) == equal(x, y) +// - Pure: equal(x, y) does not modify x or y +func Comparer(f interface{}) Option { + v := reflect.ValueOf(f) + if !function.IsType(v.Type(), function.Equal) || v.IsNil() { + panic(fmt.Sprintf("invalid comparer function: %T", f)) + } + cm := &comparer{fnc: v} + if ti := v.Type().In(0); ti.Kind() != reflect.Interface || ti.NumMethod() > 0 { + cm.typ = ti + } + return cm +} + +type comparer struct { + core + typ reflect.Type // T + fnc reflect.Value // func(T, T) bool +} + +func (cm *comparer) isFiltered() bool { return cm.typ != nil } + +func (cm *comparer) filter(_ *state, t reflect.Type, _, _ reflect.Value) applicableOption { + if cm.typ == nil || t.AssignableTo(cm.typ) { + return cm + } + return nil +} + +func (cm *comparer) apply(s *state, vx, vy reflect.Value) { + eq := s.callTTBFunc(cm.fnc, vx, vy) + s.report(eq, reportByFunc) +} + +func (cm comparer) String() string { + return fmt.Sprintf("Comparer(%s)", function.NameOf(cm.fnc)) +} + +// Exporter returns an [Option] that specifies whether [Equal] is allowed to +// introspect into the unexported fields of certain struct types. +// +// Users of this option must understand that comparing on unexported fields +// from external packages is not safe since changes in the internal +// implementation of some external package may cause the result of [Equal] +// to unexpectedly change. However, it may be valid to use this option on types +// defined in an internal package where the semantic meaning of an unexported +// field is in the control of the user. +// +// In many cases, a custom [Comparer] should be used instead that defines +// equality as a function of the public API of a type rather than the underlying +// unexported implementation. +// +// For example, the [reflect.Type] documentation defines equality to be determined +// by the == operator on the interface (essentially performing a shallow pointer +// comparison) and most attempts to compare *[regexp.Regexp] types are interested +// in only checking that the regular expression strings are equal. +// Both of these are accomplished using [Comparer] options: +// +// Comparer(func(x, y reflect.Type) bool { return x == y }) +// Comparer(func(x, y *regexp.Regexp) bool { return x.String() == y.String() }) +// +// In other cases, the [github.com/google/go-cmp/cmp/cmpopts.IgnoreUnexported] +// option can be used to ignore all unexported fields on specified struct types. +func Exporter(f func(reflect.Type) bool) Option { + return exporter(f) +} + +type exporter func(reflect.Type) bool + +func (exporter) filter(_ *state, _ reflect.Type, _, _ reflect.Value) applicableOption { + panic("not implemented") +} + +// AllowUnexported returns an [Option] that allows [Equal] to forcibly introspect +// unexported fields of the specified struct types. +// +// See [Exporter] for the proper use of this option. +func AllowUnexported(types ...interface{}) Option { + m := make(map[reflect.Type]bool) + for _, typ := range types { + t := reflect.TypeOf(typ) + if t.Kind() != reflect.Struct { + panic(fmt.Sprintf("invalid struct type: %T", typ)) + } + m[t] = true + } + return exporter(func(t reflect.Type) bool { return m[t] }) +} + +// Result represents the comparison result for a single node and +// is provided by cmp when calling Report (see [Reporter]). +type Result struct { + _ [0]func() // Make Result incomparable + flags resultFlags +} + +// Equal reports whether the node was determined to be equal or not. +// As a special case, ignored nodes are considered equal. +func (r Result) Equal() bool { + return r.flags&(reportEqual|reportByIgnore) != 0 +} + +// ByIgnore reports whether the node is equal because it was ignored. +// This never reports true if [Result.Equal] reports false. +func (r Result) ByIgnore() bool { + return r.flags&reportByIgnore != 0 +} + +// ByMethod reports whether the Equal method determined equality. +func (r Result) ByMethod() bool { + return r.flags&reportByMethod != 0 +} + +// ByFunc reports whether a [Comparer] function determined equality. +func (r Result) ByFunc() bool { + return r.flags&reportByFunc != 0 +} + +// ByCycle reports whether a reference cycle was detected. +func (r Result) ByCycle() bool { + return r.flags&reportByCycle != 0 +} + +type resultFlags uint + +const ( + _ resultFlags = (1 << iota) / 2 + + reportEqual + reportUnequal + reportByIgnore + reportByMethod + reportByFunc + reportByCycle +) + +// Reporter is an [Option] that can be passed to [Equal]. When [Equal] traverses +// the value trees, it calls PushStep as it descends into each node in the +// tree and PopStep as it ascend out of the node. The leaves of the tree are +// either compared (determined to be equal or not equal) or ignored and reported +// as such by calling the Report method. +func Reporter(r interface { + // PushStep is called when a tree-traversal operation is performed. + // The PathStep itself is only valid until the step is popped. + // The PathStep.Values are valid for the duration of the entire traversal + // and must not be mutated. + // + // Equal always calls PushStep at the start to provide an operation-less + // PathStep used to report the root values. + // + // Within a slice, the exact set of inserted, removed, or modified elements + // is unspecified and may change in future implementations. + // The entries of a map are iterated through in an unspecified order. + PushStep(PathStep) + + // Report is called exactly once on leaf nodes to report whether the + // comparison identified the node as equal, unequal, or ignored. + // A leaf node is one that is immediately preceded by and followed by + // a pair of PushStep and PopStep calls. + Report(Result) + + // PopStep ascends back up the value tree. + // There is always a matching pop call for every push call. + PopStep() +}) Option { + return reporter{r} +} + +type reporter struct{ reporterIface } +type reporterIface interface { + PushStep(PathStep) + Report(Result) + PopStep() +} + +func (reporter) filter(_ *state, _ reflect.Type, _, _ reflect.Value) applicableOption { + panic("not implemented") +} + +// normalizeOption normalizes the input options such that all Options groups +// are flattened and groups with a single element are reduced to that element. +// Only coreOptions and Options containing coreOptions are allowed. +func normalizeOption(src Option) Option { + switch opts := flattenOptions(nil, Options{src}); len(opts) { + case 0: + return nil + case 1: + return opts[0] + default: + return opts + } +} + +// flattenOptions copies all options in src to dst as a flat list. +// Only coreOptions and Options containing coreOptions are allowed. +func flattenOptions(dst, src Options) Options { + for _, opt := range src { + switch opt := opt.(type) { + case nil: + continue + case Options: + dst = flattenOptions(dst, opt) + case coreOption: + dst = append(dst, opt) + default: + panic(fmt.Sprintf("invalid option type: %T", opt)) + } + } + return dst +} diff --git a/vendor/github.com/google/go-cmp/cmp/path.go b/vendor/github.com/google/go-cmp/cmp/path.go new file mode 100644 index 0000000..c3c1456 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/path.go @@ -0,0 +1,390 @@ +// Copyright 2017, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cmp + +import ( + "fmt" + "reflect" + "strings" + "unicode" + "unicode/utf8" + + "github.com/google/go-cmp/cmp/internal/value" +) + +// Path is a list of [PathStep] describing the sequence of operations to get +// from some root type to the current position in the value tree. +// The first Path element is always an operation-less [PathStep] that exists +// simply to identify the initial type. +// +// When traversing structs with embedded structs, the embedded struct will +// always be accessed as a field before traversing the fields of the +// embedded struct themselves. That is, an exported field from the +// embedded struct will never be accessed directly from the parent struct. +type Path []PathStep + +// PathStep is a union-type for specific operations to traverse +// a value's tree structure. Users of this package never need to implement +// these types as values of this type will be returned by this package. +// +// Implementations of this interface: +// - [StructField] +// - [SliceIndex] +// - [MapIndex] +// - [Indirect] +// - [TypeAssertion] +// - [Transform] +type PathStep interface { + String() string + + // Type is the resulting type after performing the path step. + Type() reflect.Type + + // Values is the resulting values after performing the path step. + // The type of each valid value is guaranteed to be identical to Type. + // + // In some cases, one or both may be invalid or have restrictions: + // - For StructField, both are not interface-able if the current field + // is unexported and the struct type is not explicitly permitted by + // an Exporter to traverse unexported fields. + // - For SliceIndex, one may be invalid if an element is missing from + // either the x or y slice. + // - For MapIndex, one may be invalid if an entry is missing from + // either the x or y map. + // + // The provided values must not be mutated. + Values() (vx, vy reflect.Value) +} + +var ( + _ PathStep = StructField{} + _ PathStep = SliceIndex{} + _ PathStep = MapIndex{} + _ PathStep = Indirect{} + _ PathStep = TypeAssertion{} + _ PathStep = Transform{} +) + +func (pa *Path) push(s PathStep) { + *pa = append(*pa, s) +} + +func (pa *Path) pop() { + *pa = (*pa)[:len(*pa)-1] +} + +// Last returns the last [PathStep] in the Path. +// If the path is empty, this returns a non-nil [PathStep] +// that reports a nil [PathStep.Type]. +func (pa Path) Last() PathStep { + return pa.Index(-1) +} + +// Index returns the ith step in the Path and supports negative indexing. +// A negative index starts counting from the tail of the Path such that -1 +// refers to the last step, -2 refers to the second-to-last step, and so on. +// If index is invalid, this returns a non-nil [PathStep] +// that reports a nil [PathStep.Type]. +func (pa Path) Index(i int) PathStep { + if i < 0 { + i = len(pa) + i + } + if i < 0 || i >= len(pa) { + return pathStep{} + } + return pa[i] +} + +// String returns the simplified path to a node. +// The simplified path only contains struct field accesses. +// +// For example: +// +// MyMap.MySlices.MyField +func (pa Path) String() string { + var ss []string + for _, s := range pa { + if _, ok := s.(StructField); ok { + ss = append(ss, s.String()) + } + } + return strings.TrimPrefix(strings.Join(ss, ""), ".") +} + +// GoString returns the path to a specific node using Go syntax. +// +// For example: +// +// (*root.MyMap["key"].(*mypkg.MyStruct).MySlices)[2][3].MyField +func (pa Path) GoString() string { + var ssPre, ssPost []string + var numIndirect int + for i, s := range pa { + var nextStep PathStep + if i+1 < len(pa) { + nextStep = pa[i+1] + } + switch s := s.(type) { + case Indirect: + numIndirect++ + pPre, pPost := "(", ")" + switch nextStep.(type) { + case Indirect: + continue // Next step is indirection, so let them batch up + case StructField: + numIndirect-- // Automatic indirection on struct fields + case nil: + pPre, pPost = "", "" // Last step; no need for parenthesis + } + if numIndirect > 0 { + ssPre = append(ssPre, pPre+strings.Repeat("*", numIndirect)) + ssPost = append(ssPost, pPost) + } + numIndirect = 0 + continue + case Transform: + ssPre = append(ssPre, s.trans.name+"(") + ssPost = append(ssPost, ")") + continue + } + ssPost = append(ssPost, s.String()) + } + for i, j := 0, len(ssPre)-1; i < j; i, j = i+1, j-1 { + ssPre[i], ssPre[j] = ssPre[j], ssPre[i] + } + return strings.Join(ssPre, "") + strings.Join(ssPost, "") +} + +type pathStep struct { + typ reflect.Type + vx, vy reflect.Value +} + +func (ps pathStep) Type() reflect.Type { return ps.typ } +func (ps pathStep) Values() (vx, vy reflect.Value) { return ps.vx, ps.vy } +func (ps pathStep) String() string { + if ps.typ == nil { + return "" + } + s := value.TypeString(ps.typ, false) + if s == "" || strings.ContainsAny(s, "{}\n") { + return "root" // Type too simple or complex to print + } + return fmt.Sprintf("{%s}", s) +} + +// StructField is a [PathStep] that represents a struct field access +// on a field called [StructField.Name]. +type StructField struct{ *structField } +type structField struct { + pathStep + name string + idx int + + // These fields are used for forcibly accessing an unexported field. + // pvx, pvy, and field are only valid if unexported is true. + unexported bool + mayForce bool // Forcibly allow visibility + paddr bool // Was parent addressable? + pvx, pvy reflect.Value // Parent values (always addressable) + field reflect.StructField // Field information +} + +func (sf StructField) Type() reflect.Type { return sf.typ } +func (sf StructField) Values() (vx, vy reflect.Value) { + if !sf.unexported { + return sf.vx, sf.vy // CanInterface reports true + } + + // Forcibly obtain read-write access to an unexported struct field. + if sf.mayForce { + vx = retrieveUnexportedField(sf.pvx, sf.field, sf.paddr) + vy = retrieveUnexportedField(sf.pvy, sf.field, sf.paddr) + return vx, vy // CanInterface reports true + } + return sf.vx, sf.vy // CanInterface reports false +} +func (sf StructField) String() string { return fmt.Sprintf(".%s", sf.name) } + +// Name is the field name. +func (sf StructField) Name() string { return sf.name } + +// Index is the index of the field in the parent struct type. +// See [reflect.Type.Field]. +func (sf StructField) Index() int { return sf.idx } + +// SliceIndex is a [PathStep] that represents an index operation on +// a slice or array at some index [SliceIndex.Key]. +type SliceIndex struct{ *sliceIndex } +type sliceIndex struct { + pathStep + xkey, ykey int + isSlice bool // False for reflect.Array +} + +func (si SliceIndex) Type() reflect.Type { return si.typ } +func (si SliceIndex) Values() (vx, vy reflect.Value) { return si.vx, si.vy } +func (si SliceIndex) String() string { + switch { + case si.xkey == si.ykey: + return fmt.Sprintf("[%d]", si.xkey) + case si.ykey == -1: + // [5->?] means "I don't know where X[5] went" + return fmt.Sprintf("[%d->?]", si.xkey) + case si.xkey == -1: + // [?->3] means "I don't know where Y[3] came from" + return fmt.Sprintf("[?->%d]", si.ykey) + default: + // [5->3] means "X[5] moved to Y[3]" + return fmt.Sprintf("[%d->%d]", si.xkey, si.ykey) + } +} + +// Key is the index key; it may return -1 if in a split state +func (si SliceIndex) Key() int { + if si.xkey != si.ykey { + return -1 + } + return si.xkey +} + +// SplitKeys are the indexes for indexing into slices in the +// x and y values, respectively. These indexes may differ due to the +// insertion or removal of an element in one of the slices, causing +// all of the indexes to be shifted. If an index is -1, then that +// indicates that the element does not exist in the associated slice. +// +// [SliceIndex.Key] is guaranteed to return -1 if and only if the indexes +// returned by SplitKeys are not the same. SplitKeys will never return -1 for +// both indexes. +func (si SliceIndex) SplitKeys() (ix, iy int) { return si.xkey, si.ykey } + +// MapIndex is a [PathStep] that represents an index operation on a map at some index Key. +type MapIndex struct{ *mapIndex } +type mapIndex struct { + pathStep + key reflect.Value +} + +func (mi MapIndex) Type() reflect.Type { return mi.typ } +func (mi MapIndex) Values() (vx, vy reflect.Value) { return mi.vx, mi.vy } +func (mi MapIndex) String() string { return fmt.Sprintf("[%#v]", mi.key) } + +// Key is the value of the map key. +func (mi MapIndex) Key() reflect.Value { return mi.key } + +// Indirect is a [PathStep] that represents pointer indirection on the parent type. +type Indirect struct{ *indirect } +type indirect struct { + pathStep +} + +func (in Indirect) Type() reflect.Type { return in.typ } +func (in Indirect) Values() (vx, vy reflect.Value) { return in.vx, in.vy } +func (in Indirect) String() string { return "*" } + +// TypeAssertion is a [PathStep] that represents a type assertion on an interface. +type TypeAssertion struct{ *typeAssertion } +type typeAssertion struct { + pathStep +} + +func (ta TypeAssertion) Type() reflect.Type { return ta.typ } +func (ta TypeAssertion) Values() (vx, vy reflect.Value) { return ta.vx, ta.vy } +func (ta TypeAssertion) String() string { return fmt.Sprintf(".(%v)", value.TypeString(ta.typ, false)) } + +// Transform is a [PathStep] that represents a transformation +// from the parent type to the current type. +type Transform struct{ *transform } +type transform struct { + pathStep + trans *transformer +} + +func (tf Transform) Type() reflect.Type { return tf.typ } +func (tf Transform) Values() (vx, vy reflect.Value) { return tf.vx, tf.vy } +func (tf Transform) String() string { return fmt.Sprintf("%s()", tf.trans.name) } + +// Name is the name of the [Transformer]. +func (tf Transform) Name() string { return tf.trans.name } + +// Func is the function pointer to the transformer function. +func (tf Transform) Func() reflect.Value { return tf.trans.fnc } + +// Option returns the originally constructed [Transformer] option. +// The == operator can be used to detect the exact option used. +func (tf Transform) Option() Option { return tf.trans } + +// pointerPath represents a dual-stack of pointers encountered when +// recursively traversing the x and y values. This data structure supports +// detection of cycles and determining whether the cycles are equal. +// In Go, cycles can occur via pointers, slices, and maps. +// +// The pointerPath uses a map to represent a stack; where descension into a +// pointer pushes the address onto the stack, and ascension from a pointer +// pops the address from the stack. Thus, when traversing into a pointer from +// reflect.Ptr, reflect.Slice element, or reflect.Map, we can detect cycles +// by checking whether the pointer has already been visited. The cycle detection +// uses a separate stack for the x and y values. +// +// If a cycle is detected we need to determine whether the two pointers +// should be considered equal. The definition of equality chosen by Equal +// requires two graphs to have the same structure. To determine this, both the +// x and y values must have a cycle where the previous pointers were also +// encountered together as a pair. +// +// Semantically, this is equivalent to augmenting Indirect, SliceIndex, and +// MapIndex with pointer information for the x and y values. +// Suppose px and py are two pointers to compare, we then search the +// Path for whether px was ever encountered in the Path history of x, and +// similarly so with py. If either side has a cycle, the comparison is only +// equal if both px and py have a cycle resulting from the same PathStep. +// +// Using a map as a stack is more performant as we can perform cycle detection +// in O(1) instead of O(N) where N is len(Path). +type pointerPath struct { + // mx is keyed by x pointers, where the value is the associated y pointer. + mx map[value.Pointer]value.Pointer + // my is keyed by y pointers, where the value is the associated x pointer. + my map[value.Pointer]value.Pointer +} + +func (p *pointerPath) Init() { + p.mx = make(map[value.Pointer]value.Pointer) + p.my = make(map[value.Pointer]value.Pointer) +} + +// Push indicates intent to descend into pointers vx and vy where +// visited reports whether either has been seen before. If visited before, +// equal reports whether both pointers were encountered together. +// Pop must be called if and only if the pointers were never visited. +// +// The pointers vx and vy must be a reflect.Ptr, reflect.Slice, or reflect.Map +// and be non-nil. +func (p pointerPath) Push(vx, vy reflect.Value) (equal, visited bool) { + px := value.PointerOf(vx) + py := value.PointerOf(vy) + _, ok1 := p.mx[px] + _, ok2 := p.my[py] + if ok1 || ok2 { + equal = p.mx[px] == py && p.my[py] == px // Pointers paired together + return equal, true + } + p.mx[px] = py + p.my[py] = px + return false, false +} + +// Pop ascends from pointers vx and vy. +func (p pointerPath) Pop(vx, vy reflect.Value) { + delete(p.mx, value.PointerOf(vx)) + delete(p.my, value.PointerOf(vy)) +} + +// isExported reports whether the identifier is exported. +func isExported(id string) bool { + r, _ := utf8.DecodeRuneInString(id) + return unicode.IsUpper(r) +} diff --git a/vendor/github.com/google/go-cmp/cmp/report.go b/vendor/github.com/google/go-cmp/cmp/report.go new file mode 100644 index 0000000..f43cd12 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/report.go @@ -0,0 +1,54 @@ +// Copyright 2017, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cmp + +// defaultReporter implements the reporter interface. +// +// As Equal serially calls the PushStep, Report, and PopStep methods, the +// defaultReporter constructs a tree-based representation of the compared value +// and the result of each comparison (see valueNode). +// +// When the String method is called, the FormatDiff method transforms the +// valueNode tree into a textNode tree, which is a tree-based representation +// of the textual output (see textNode). +// +// Lastly, the textNode.String method produces the final report as a string. +type defaultReporter struct { + root *valueNode + curr *valueNode +} + +func (r *defaultReporter) PushStep(ps PathStep) { + r.curr = r.curr.PushStep(ps) + if r.root == nil { + r.root = r.curr + } +} +func (r *defaultReporter) Report(rs Result) { + r.curr.Report(rs) +} +func (r *defaultReporter) PopStep() { + r.curr = r.curr.PopStep() +} + +// String provides a full report of the differences detected as a structured +// literal in pseudo-Go syntax. String may only be called after the entire tree +// has been traversed. +func (r *defaultReporter) String() string { + assert(r.root != nil && r.curr == nil) + if r.root.NumDiff == 0 { + return "" + } + ptrs := new(pointerReferences) + text := formatOptions{}.FormatDiff(r.root, ptrs) + resolveReferences(text) + return text.String() +} + +func assert(ok bool) { + if !ok { + panic("assertion failure") + } +} diff --git a/vendor/github.com/google/go-cmp/cmp/report_compare.go b/vendor/github.com/google/go-cmp/cmp/report_compare.go new file mode 100644 index 0000000..2050bf6 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/report_compare.go @@ -0,0 +1,433 @@ +// Copyright 2019, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cmp + +import ( + "fmt" + "reflect" +) + +// numContextRecords is the number of surrounding equal records to print. +const numContextRecords = 2 + +type diffMode byte + +const ( + diffUnknown diffMode = 0 + diffIdentical diffMode = ' ' + diffRemoved diffMode = '-' + diffInserted diffMode = '+' +) + +type typeMode int + +const ( + // emitType always prints the type. + emitType typeMode = iota + // elideType never prints the type. + elideType + // autoType prints the type only for composite kinds + // (i.e., structs, slices, arrays, and maps). + autoType +) + +type formatOptions struct { + // DiffMode controls the output mode of FormatDiff. + // + // If diffUnknown, then produce a diff of the x and y values. + // If diffIdentical, then emit values as if they were equal. + // If diffRemoved, then only emit x values (ignoring y values). + // If diffInserted, then only emit y values (ignoring x values). + DiffMode diffMode + + // TypeMode controls whether to print the type for the current node. + // + // As a general rule of thumb, we always print the type of the next node + // after an interface, and always elide the type of the next node after + // a slice or map node. + TypeMode typeMode + + // formatValueOptions are options specific to printing reflect.Values. + formatValueOptions +} + +func (opts formatOptions) WithDiffMode(d diffMode) formatOptions { + opts.DiffMode = d + return opts +} +func (opts formatOptions) WithTypeMode(t typeMode) formatOptions { + opts.TypeMode = t + return opts +} +func (opts formatOptions) WithVerbosity(level int) formatOptions { + opts.VerbosityLevel = level + opts.LimitVerbosity = true + return opts +} +func (opts formatOptions) verbosity() uint { + switch { + case opts.VerbosityLevel < 0: + return 0 + case opts.VerbosityLevel > 16: + return 16 // some reasonable maximum to avoid shift overflow + default: + return uint(opts.VerbosityLevel) + } +} + +const maxVerbosityPreset = 6 + +// verbosityPreset modifies the verbosity settings given an index +// between 0 and maxVerbosityPreset, inclusive. +func verbosityPreset(opts formatOptions, i int) formatOptions { + opts.VerbosityLevel = int(opts.verbosity()) + 2*i + if i > 0 { + opts.AvoidStringer = true + } + if i >= maxVerbosityPreset { + opts.PrintAddresses = true + opts.QualifiedNames = true + } + return opts +} + +// FormatDiff converts a valueNode tree into a textNode tree, where the later +// is a textual representation of the differences detected in the former. +func (opts formatOptions) FormatDiff(v *valueNode, ptrs *pointerReferences) (out textNode) { + if opts.DiffMode == diffIdentical { + opts = opts.WithVerbosity(1) + } else if opts.verbosity() < 3 { + opts = opts.WithVerbosity(3) + } + + // Check whether we have specialized formatting for this node. + // This is not necessary, but helpful for producing more readable outputs. + if opts.CanFormatDiffSlice(v) { + return opts.FormatDiffSlice(v) + } + + var parentKind reflect.Kind + if v.parent != nil && v.parent.TransformerName == "" { + parentKind = v.parent.Type.Kind() + } + + // For leaf nodes, format the value based on the reflect.Values alone. + // As a special case, treat equal []byte as a leaf nodes. + isBytes := v.Type.Kind() == reflect.Slice && v.Type.Elem() == byteType + isEqualBytes := isBytes && v.NumDiff+v.NumIgnored+v.NumTransformed == 0 + if v.MaxDepth == 0 || isEqualBytes { + switch opts.DiffMode { + case diffUnknown, diffIdentical: + // Format Equal. + if v.NumDiff == 0 { + outx := opts.FormatValue(v.ValueX, parentKind, ptrs) + outy := opts.FormatValue(v.ValueY, parentKind, ptrs) + if v.NumIgnored > 0 && v.NumSame == 0 { + return textEllipsis + } else if outx.Len() < outy.Len() { + return outx + } else { + return outy + } + } + + // Format unequal. + assert(opts.DiffMode == diffUnknown) + var list textList + outx := opts.WithTypeMode(elideType).FormatValue(v.ValueX, parentKind, ptrs) + outy := opts.WithTypeMode(elideType).FormatValue(v.ValueY, parentKind, ptrs) + for i := 0; i <= maxVerbosityPreset && outx != nil && outy != nil && outx.Equal(outy); i++ { + opts2 := verbosityPreset(opts, i).WithTypeMode(elideType) + outx = opts2.FormatValue(v.ValueX, parentKind, ptrs) + outy = opts2.FormatValue(v.ValueY, parentKind, ptrs) + } + if outx != nil { + list = append(list, textRecord{Diff: '-', Value: outx}) + } + if outy != nil { + list = append(list, textRecord{Diff: '+', Value: outy}) + } + return opts.WithTypeMode(emitType).FormatType(v.Type, list) + case diffRemoved: + return opts.FormatValue(v.ValueX, parentKind, ptrs) + case diffInserted: + return opts.FormatValue(v.ValueY, parentKind, ptrs) + default: + panic("invalid diff mode") + } + } + + // Register slice element to support cycle detection. + if parentKind == reflect.Slice { + ptrRefs := ptrs.PushPair(v.ValueX, v.ValueY, opts.DiffMode, true) + defer ptrs.Pop() + defer func() { out = wrapTrunkReferences(ptrRefs, out) }() + } + + // Descend into the child value node. + if v.TransformerName != "" { + out := opts.WithTypeMode(emitType).FormatDiff(v.Value, ptrs) + out = &textWrap{Prefix: "Inverse(" + v.TransformerName + ", ", Value: out, Suffix: ")"} + return opts.FormatType(v.Type, out) + } else { + switch k := v.Type.Kind(); k { + case reflect.Struct, reflect.Array, reflect.Slice: + out = opts.formatDiffList(v.Records, k, ptrs) + out = opts.FormatType(v.Type, out) + case reflect.Map: + // Register map to support cycle detection. + ptrRefs := ptrs.PushPair(v.ValueX, v.ValueY, opts.DiffMode, false) + defer ptrs.Pop() + + out = opts.formatDiffList(v.Records, k, ptrs) + out = wrapTrunkReferences(ptrRefs, out) + out = opts.FormatType(v.Type, out) + case reflect.Ptr: + // Register pointer to support cycle detection. + ptrRefs := ptrs.PushPair(v.ValueX, v.ValueY, opts.DiffMode, false) + defer ptrs.Pop() + + out = opts.FormatDiff(v.Value, ptrs) + out = wrapTrunkReferences(ptrRefs, out) + out = &textWrap{Prefix: "&", Value: out} + case reflect.Interface: + out = opts.WithTypeMode(emitType).FormatDiff(v.Value, ptrs) + default: + panic(fmt.Sprintf("%v cannot have children", k)) + } + return out + } +} + +func (opts formatOptions) formatDiffList(recs []reportRecord, k reflect.Kind, ptrs *pointerReferences) textNode { + // Derive record name based on the data structure kind. + var name string + var formatKey func(reflect.Value) string + switch k { + case reflect.Struct: + name = "field" + opts = opts.WithTypeMode(autoType) + formatKey = func(v reflect.Value) string { return v.String() } + case reflect.Slice, reflect.Array: + name = "element" + opts = opts.WithTypeMode(elideType) + formatKey = func(reflect.Value) string { return "" } + case reflect.Map: + name = "entry" + opts = opts.WithTypeMode(elideType) + formatKey = func(v reflect.Value) string { return formatMapKey(v, false, ptrs) } + } + + maxLen := -1 + if opts.LimitVerbosity { + if opts.DiffMode == diffIdentical { + maxLen = ((1 << opts.verbosity()) >> 1) << 2 // 0, 4, 8, 16, 32, etc... + } else { + maxLen = (1 << opts.verbosity()) << 1 // 2, 4, 8, 16, 32, 64, etc... + } + opts.VerbosityLevel-- + } + + // Handle unification. + switch opts.DiffMode { + case diffIdentical, diffRemoved, diffInserted: + var list textList + var deferredEllipsis bool // Add final "..." to indicate records were dropped + for _, r := range recs { + if len(list) == maxLen { + deferredEllipsis = true + break + } + + // Elide struct fields that are zero value. + if k == reflect.Struct { + var isZero bool + switch opts.DiffMode { + case diffIdentical: + isZero = r.Value.ValueX.IsZero() || r.Value.ValueY.IsZero() + case diffRemoved: + isZero = r.Value.ValueX.IsZero() + case diffInserted: + isZero = r.Value.ValueY.IsZero() + } + if isZero { + continue + } + } + // Elide ignored nodes. + if r.Value.NumIgnored > 0 && r.Value.NumSame+r.Value.NumDiff == 0 { + deferredEllipsis = !(k == reflect.Slice || k == reflect.Array) + if !deferredEllipsis { + list.AppendEllipsis(diffStats{}) + } + continue + } + if out := opts.FormatDiff(r.Value, ptrs); out != nil { + list = append(list, textRecord{Key: formatKey(r.Key), Value: out}) + } + } + if deferredEllipsis { + list.AppendEllipsis(diffStats{}) + } + return &textWrap{Prefix: "{", Value: list, Suffix: "}"} + case diffUnknown: + default: + panic("invalid diff mode") + } + + // Handle differencing. + var numDiffs int + var list textList + var keys []reflect.Value // invariant: len(list) == len(keys) + groups := coalesceAdjacentRecords(name, recs) + maxGroup := diffStats{Name: name} + for i, ds := range groups { + if maxLen >= 0 && numDiffs >= maxLen { + maxGroup = maxGroup.Append(ds) + continue + } + + // Handle equal records. + if ds.NumDiff() == 0 { + // Compute the number of leading and trailing records to print. + var numLo, numHi int + numEqual := ds.NumIgnored + ds.NumIdentical + for numLo < numContextRecords && numLo+numHi < numEqual && i != 0 { + if r := recs[numLo].Value; r.NumIgnored > 0 && r.NumSame+r.NumDiff == 0 { + break + } + numLo++ + } + for numHi < numContextRecords && numLo+numHi < numEqual && i != len(groups)-1 { + if r := recs[numEqual-numHi-1].Value; r.NumIgnored > 0 && r.NumSame+r.NumDiff == 0 { + break + } + numHi++ + } + if numEqual-(numLo+numHi) == 1 && ds.NumIgnored == 0 { + numHi++ // Avoid pointless coalescing of a single equal record + } + + // Format the equal values. + for _, r := range recs[:numLo] { + out := opts.WithDiffMode(diffIdentical).FormatDiff(r.Value, ptrs) + list = append(list, textRecord{Key: formatKey(r.Key), Value: out}) + keys = append(keys, r.Key) + } + if numEqual > numLo+numHi { + ds.NumIdentical -= numLo + numHi + list.AppendEllipsis(ds) + for len(keys) < len(list) { + keys = append(keys, reflect.Value{}) + } + } + for _, r := range recs[numEqual-numHi : numEqual] { + out := opts.WithDiffMode(diffIdentical).FormatDiff(r.Value, ptrs) + list = append(list, textRecord{Key: formatKey(r.Key), Value: out}) + keys = append(keys, r.Key) + } + recs = recs[numEqual:] + continue + } + + // Handle unequal records. + for _, r := range recs[:ds.NumDiff()] { + switch { + case opts.CanFormatDiffSlice(r.Value): + out := opts.FormatDiffSlice(r.Value) + list = append(list, textRecord{Key: formatKey(r.Key), Value: out}) + keys = append(keys, r.Key) + case r.Value.NumChildren == r.Value.MaxDepth: + outx := opts.WithDiffMode(diffRemoved).FormatDiff(r.Value, ptrs) + outy := opts.WithDiffMode(diffInserted).FormatDiff(r.Value, ptrs) + for i := 0; i <= maxVerbosityPreset && outx != nil && outy != nil && outx.Equal(outy); i++ { + opts2 := verbosityPreset(opts, i) + outx = opts2.WithDiffMode(diffRemoved).FormatDiff(r.Value, ptrs) + outy = opts2.WithDiffMode(diffInserted).FormatDiff(r.Value, ptrs) + } + if outx != nil { + list = append(list, textRecord{Diff: diffRemoved, Key: formatKey(r.Key), Value: outx}) + keys = append(keys, r.Key) + } + if outy != nil { + list = append(list, textRecord{Diff: diffInserted, Key: formatKey(r.Key), Value: outy}) + keys = append(keys, r.Key) + } + default: + out := opts.FormatDiff(r.Value, ptrs) + list = append(list, textRecord{Key: formatKey(r.Key), Value: out}) + keys = append(keys, r.Key) + } + } + recs = recs[ds.NumDiff():] + numDiffs += ds.NumDiff() + } + if maxGroup.IsZero() { + assert(len(recs) == 0) + } else { + list.AppendEllipsis(maxGroup) + for len(keys) < len(list) { + keys = append(keys, reflect.Value{}) + } + } + assert(len(list) == len(keys)) + + // For maps, the default formatting logic uses fmt.Stringer which may + // produce ambiguous output. Avoid calling String to disambiguate. + if k == reflect.Map { + var ambiguous bool + seenKeys := map[string]reflect.Value{} + for i, currKey := range keys { + if currKey.IsValid() { + strKey := list[i].Key + prevKey, seen := seenKeys[strKey] + if seen && prevKey.CanInterface() && currKey.CanInterface() { + ambiguous = prevKey.Interface() != currKey.Interface() + if ambiguous { + break + } + } + seenKeys[strKey] = currKey + } + } + if ambiguous { + for i, k := range keys { + if k.IsValid() { + list[i].Key = formatMapKey(k, true, ptrs) + } + } + } + } + + return &textWrap{Prefix: "{", Value: list, Suffix: "}"} +} + +// coalesceAdjacentRecords coalesces the list of records into groups of +// adjacent equal, or unequal counts. +func coalesceAdjacentRecords(name string, recs []reportRecord) (groups []diffStats) { + var prevCase int // Arbitrary index into which case last occurred + lastStats := func(i int) *diffStats { + if prevCase != i { + groups = append(groups, diffStats{Name: name}) + prevCase = i + } + return &groups[len(groups)-1] + } + for _, r := range recs { + switch rv := r.Value; { + case rv.NumIgnored > 0 && rv.NumSame+rv.NumDiff == 0: + lastStats(1).NumIgnored++ + case rv.NumDiff == 0: + lastStats(1).NumIdentical++ + case rv.NumDiff > 0 && !rv.ValueY.IsValid(): + lastStats(2).NumRemoved++ + case rv.NumDiff > 0 && !rv.ValueX.IsValid(): + lastStats(2).NumInserted++ + default: + lastStats(2).NumModified++ + } + } + return groups +} diff --git a/vendor/github.com/google/go-cmp/cmp/report_references.go b/vendor/github.com/google/go-cmp/cmp/report_references.go new file mode 100644 index 0000000..be31b33 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/report_references.go @@ -0,0 +1,264 @@ +// Copyright 2020, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cmp + +import ( + "fmt" + "reflect" + "strings" + + "github.com/google/go-cmp/cmp/internal/flags" + "github.com/google/go-cmp/cmp/internal/value" +) + +const ( + pointerDelimPrefix = "⟪" + pointerDelimSuffix = "⟫" +) + +// formatPointer prints the address of the pointer. +func formatPointer(p value.Pointer, withDelims bool) string { + v := p.Uintptr() + if flags.Deterministic { + v = 0xdeadf00f // Only used for stable testing purposes + } + if withDelims { + return pointerDelimPrefix + formatHex(uint64(v)) + pointerDelimSuffix + } + return formatHex(uint64(v)) +} + +// pointerReferences is a stack of pointers visited so far. +type pointerReferences [][2]value.Pointer + +func (ps *pointerReferences) PushPair(vx, vy reflect.Value, d diffMode, deref bool) (pp [2]value.Pointer) { + if deref && vx.IsValid() { + vx = vx.Addr() + } + if deref && vy.IsValid() { + vy = vy.Addr() + } + switch d { + case diffUnknown, diffIdentical: + pp = [2]value.Pointer{value.PointerOf(vx), value.PointerOf(vy)} + case diffRemoved: + pp = [2]value.Pointer{value.PointerOf(vx), value.Pointer{}} + case diffInserted: + pp = [2]value.Pointer{value.Pointer{}, value.PointerOf(vy)} + } + *ps = append(*ps, pp) + return pp +} + +func (ps *pointerReferences) Push(v reflect.Value) (p value.Pointer, seen bool) { + p = value.PointerOf(v) + for _, pp := range *ps { + if p == pp[0] || p == pp[1] { + return p, true + } + } + *ps = append(*ps, [2]value.Pointer{p, p}) + return p, false +} + +func (ps *pointerReferences) Pop() { + *ps = (*ps)[:len(*ps)-1] +} + +// trunkReferences is metadata for a textNode indicating that the sub-tree +// represents the value for either pointer in a pair of references. +type trunkReferences struct{ pp [2]value.Pointer } + +// trunkReference is metadata for a textNode indicating that the sub-tree +// represents the value for the given pointer reference. +type trunkReference struct{ p value.Pointer } + +// leafReference is metadata for a textNode indicating that the value is +// truncated as it refers to another part of the tree (i.e., a trunk). +type leafReference struct{ p value.Pointer } + +func wrapTrunkReferences(pp [2]value.Pointer, s textNode) textNode { + switch { + case pp[0].IsNil(): + return &textWrap{Value: s, Metadata: trunkReference{pp[1]}} + case pp[1].IsNil(): + return &textWrap{Value: s, Metadata: trunkReference{pp[0]}} + case pp[0] == pp[1]: + return &textWrap{Value: s, Metadata: trunkReference{pp[0]}} + default: + return &textWrap{Value: s, Metadata: trunkReferences{pp}} + } +} +func wrapTrunkReference(p value.Pointer, printAddress bool, s textNode) textNode { + var prefix string + if printAddress { + prefix = formatPointer(p, true) + } + return &textWrap{Prefix: prefix, Value: s, Metadata: trunkReference{p}} +} +func makeLeafReference(p value.Pointer, printAddress bool) textNode { + out := &textWrap{Prefix: "(", Value: textEllipsis, Suffix: ")"} + var prefix string + if printAddress { + prefix = formatPointer(p, true) + } + return &textWrap{Prefix: prefix, Value: out, Metadata: leafReference{p}} +} + +// resolveReferences walks the textNode tree searching for any leaf reference +// metadata and resolves each against the corresponding trunk references. +// Since pointer addresses in memory are not particularly readable to the user, +// it replaces each pointer value with an arbitrary and unique reference ID. +func resolveReferences(s textNode) { + var walkNodes func(textNode, func(textNode)) + walkNodes = func(s textNode, f func(textNode)) { + f(s) + switch s := s.(type) { + case *textWrap: + walkNodes(s.Value, f) + case textList: + for _, r := range s { + walkNodes(r.Value, f) + } + } + } + + // Collect all trunks and leaves with reference metadata. + var trunks, leaves []*textWrap + walkNodes(s, func(s textNode) { + if s, ok := s.(*textWrap); ok { + switch s.Metadata.(type) { + case leafReference: + leaves = append(leaves, s) + case trunkReference, trunkReferences: + trunks = append(trunks, s) + } + } + }) + + // No leaf references to resolve. + if len(leaves) == 0 { + return + } + + // Collect the set of all leaf references to resolve. + leafPtrs := make(map[value.Pointer]bool) + for _, leaf := range leaves { + leafPtrs[leaf.Metadata.(leafReference).p] = true + } + + // Collect the set of trunk pointers that are always paired together. + // This allows us to assign a single ID to both pointers for brevity. + // If a pointer in a pair ever occurs by itself or as a different pair, + // then the pair is broken. + pairedTrunkPtrs := make(map[value.Pointer]value.Pointer) + unpair := func(p value.Pointer) { + if !pairedTrunkPtrs[p].IsNil() { + pairedTrunkPtrs[pairedTrunkPtrs[p]] = value.Pointer{} // invalidate other half + } + pairedTrunkPtrs[p] = value.Pointer{} // invalidate this half + } + for _, trunk := range trunks { + switch p := trunk.Metadata.(type) { + case trunkReference: + unpair(p.p) // standalone pointer cannot be part of a pair + case trunkReferences: + p0, ok0 := pairedTrunkPtrs[p.pp[0]] + p1, ok1 := pairedTrunkPtrs[p.pp[1]] + switch { + case !ok0 && !ok1: + // Register the newly seen pair. + pairedTrunkPtrs[p.pp[0]] = p.pp[1] + pairedTrunkPtrs[p.pp[1]] = p.pp[0] + case ok0 && ok1 && p0 == p.pp[1] && p1 == p.pp[0]: + // Exact pair already seen; do nothing. + default: + // Pair conflicts with some other pair; break all pairs. + unpair(p.pp[0]) + unpair(p.pp[1]) + } + } + } + + // Correlate each pointer referenced by leaves to a unique identifier, + // and print the IDs for each trunk that matches those pointers. + var nextID uint + ptrIDs := make(map[value.Pointer]uint) + newID := func() uint { + id := nextID + nextID++ + return id + } + for _, trunk := range trunks { + switch p := trunk.Metadata.(type) { + case trunkReference: + if print := leafPtrs[p.p]; print { + id, ok := ptrIDs[p.p] + if !ok { + id = newID() + ptrIDs[p.p] = id + } + trunk.Prefix = updateReferencePrefix(trunk.Prefix, formatReference(id)) + } + case trunkReferences: + print0 := leafPtrs[p.pp[0]] + print1 := leafPtrs[p.pp[1]] + if print0 || print1 { + id0, ok0 := ptrIDs[p.pp[0]] + id1, ok1 := ptrIDs[p.pp[1]] + isPair := pairedTrunkPtrs[p.pp[0]] == p.pp[1] && pairedTrunkPtrs[p.pp[1]] == p.pp[0] + if isPair { + var id uint + assert(ok0 == ok1) // must be seen together or not at all + if ok0 { + assert(id0 == id1) // must have the same ID + id = id0 + } else { + id = newID() + ptrIDs[p.pp[0]] = id + ptrIDs[p.pp[1]] = id + } + trunk.Prefix = updateReferencePrefix(trunk.Prefix, formatReference(id)) + } else { + if print0 && !ok0 { + id0 = newID() + ptrIDs[p.pp[0]] = id0 + } + if print1 && !ok1 { + id1 = newID() + ptrIDs[p.pp[1]] = id1 + } + switch { + case print0 && print1: + trunk.Prefix = updateReferencePrefix(trunk.Prefix, formatReference(id0)+","+formatReference(id1)) + case print0: + trunk.Prefix = updateReferencePrefix(trunk.Prefix, formatReference(id0)) + case print1: + trunk.Prefix = updateReferencePrefix(trunk.Prefix, formatReference(id1)) + } + } + } + } + } + + // Update all leaf references with the unique identifier. + for _, leaf := range leaves { + if id, ok := ptrIDs[leaf.Metadata.(leafReference).p]; ok { + leaf.Prefix = updateReferencePrefix(leaf.Prefix, formatReference(id)) + } + } +} + +func formatReference(id uint) string { + return fmt.Sprintf("ref#%d", id) +} + +func updateReferencePrefix(prefix, ref string) string { + if prefix == "" { + return pointerDelimPrefix + ref + pointerDelimSuffix + } + suffix := strings.TrimPrefix(prefix, pointerDelimPrefix) + return pointerDelimPrefix + ref + ": " + suffix +} diff --git a/vendor/github.com/google/go-cmp/cmp/report_reflect.go b/vendor/github.com/google/go-cmp/cmp/report_reflect.go new file mode 100644 index 0000000..e39f422 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/report_reflect.go @@ -0,0 +1,414 @@ +// Copyright 2019, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cmp + +import ( + "bytes" + "fmt" + "reflect" + "strconv" + "strings" + "unicode" + "unicode/utf8" + + "github.com/google/go-cmp/cmp/internal/value" +) + +var ( + anyType = reflect.TypeOf((*interface{})(nil)).Elem() + stringType = reflect.TypeOf((*string)(nil)).Elem() + bytesType = reflect.TypeOf((*[]byte)(nil)).Elem() + byteType = reflect.TypeOf((*byte)(nil)).Elem() +) + +type formatValueOptions struct { + // AvoidStringer controls whether to avoid calling custom stringer + // methods like error.Error or fmt.Stringer.String. + AvoidStringer bool + + // PrintAddresses controls whether to print the address of all pointers, + // slice elements, and maps. + PrintAddresses bool + + // QualifiedNames controls whether FormatType uses the fully qualified name + // (including the full package path as opposed to just the package name). + QualifiedNames bool + + // VerbosityLevel controls the amount of output to produce. + // A higher value produces more output. A value of zero or lower produces + // no output (represented using an ellipsis). + // If LimitVerbosity is false, then the level is treated as infinite. + VerbosityLevel int + + // LimitVerbosity specifies that formatting should respect VerbosityLevel. + LimitVerbosity bool +} + +// FormatType prints the type as if it were wrapping s. +// This may return s as-is depending on the current type and TypeMode mode. +func (opts formatOptions) FormatType(t reflect.Type, s textNode) textNode { + // Check whether to emit the type or not. + switch opts.TypeMode { + case autoType: + switch t.Kind() { + case reflect.Struct, reflect.Slice, reflect.Array, reflect.Map: + if s.Equal(textNil) { + return s + } + default: + return s + } + if opts.DiffMode == diffIdentical { + return s // elide type for identical nodes + } + case elideType: + return s + } + + // Determine the type label, applying special handling for unnamed types. + typeName := value.TypeString(t, opts.QualifiedNames) + if t.Name() == "" { + // According to Go grammar, certain type literals contain symbols that + // do not strongly bind to the next lexicographical token (e.g., *T). + switch t.Kind() { + case reflect.Chan, reflect.Func, reflect.Ptr: + typeName = "(" + typeName + ")" + } + } + return &textWrap{Prefix: typeName, Value: wrapParens(s)} +} + +// wrapParens wraps s with a set of parenthesis, but avoids it if the +// wrapped node itself is already surrounded by a pair of parenthesis or braces. +// It handles unwrapping one level of pointer-reference nodes. +func wrapParens(s textNode) textNode { + var refNode *textWrap + if s2, ok := s.(*textWrap); ok { + // Unwrap a single pointer reference node. + switch s2.Metadata.(type) { + case leafReference, trunkReference, trunkReferences: + refNode = s2 + if s3, ok := refNode.Value.(*textWrap); ok { + s2 = s3 + } + } + + // Already has delimiters that make parenthesis unnecessary. + hasParens := strings.HasPrefix(s2.Prefix, "(") && strings.HasSuffix(s2.Suffix, ")") + hasBraces := strings.HasPrefix(s2.Prefix, "{") && strings.HasSuffix(s2.Suffix, "}") + if hasParens || hasBraces { + return s + } + } + if refNode != nil { + refNode.Value = &textWrap{Prefix: "(", Value: refNode.Value, Suffix: ")"} + return s + } + return &textWrap{Prefix: "(", Value: s, Suffix: ")"} +} + +// FormatValue prints the reflect.Value, taking extra care to avoid descending +// into pointers already in ptrs. As pointers are visited, ptrs is also updated. +func (opts formatOptions) FormatValue(v reflect.Value, parentKind reflect.Kind, ptrs *pointerReferences) (out textNode) { + if !v.IsValid() { + return nil + } + t := v.Type() + + // Check slice element for cycles. + if parentKind == reflect.Slice { + ptrRef, visited := ptrs.Push(v.Addr()) + if visited { + return makeLeafReference(ptrRef, false) + } + defer ptrs.Pop() + defer func() { out = wrapTrunkReference(ptrRef, false, out) }() + } + + // Check whether there is an Error or String method to call. + if !opts.AvoidStringer && v.CanInterface() { + // Avoid calling Error or String methods on nil receivers since many + // implementations crash when doing so. + if (t.Kind() != reflect.Ptr && t.Kind() != reflect.Interface) || !v.IsNil() { + var prefix, strVal string + func() { + // Swallow and ignore any panics from String or Error. + defer func() { recover() }() + switch v := v.Interface().(type) { + case error: + strVal = v.Error() + prefix = "e" + case fmt.Stringer: + strVal = v.String() + prefix = "s" + } + }() + if prefix != "" { + return opts.formatString(prefix, strVal) + } + } + } + + // Check whether to explicitly wrap the result with the type. + var skipType bool + defer func() { + if !skipType { + out = opts.FormatType(t, out) + } + }() + + switch t.Kind() { + case reflect.Bool: + return textLine(fmt.Sprint(v.Bool())) + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return textLine(fmt.Sprint(v.Int())) + case reflect.Uint, reflect.Uint16, reflect.Uint32, reflect.Uint64: + return textLine(fmt.Sprint(v.Uint())) + case reflect.Uint8: + if parentKind == reflect.Slice || parentKind == reflect.Array { + return textLine(formatHex(v.Uint())) + } + return textLine(fmt.Sprint(v.Uint())) + case reflect.Uintptr: + return textLine(formatHex(v.Uint())) + case reflect.Float32, reflect.Float64: + return textLine(fmt.Sprint(v.Float())) + case reflect.Complex64, reflect.Complex128: + return textLine(fmt.Sprint(v.Complex())) + case reflect.String: + return opts.formatString("", v.String()) + case reflect.UnsafePointer, reflect.Chan, reflect.Func: + return textLine(formatPointer(value.PointerOf(v), true)) + case reflect.Struct: + var list textList + v := makeAddressable(v) // needed for retrieveUnexportedField + maxLen := v.NumField() + if opts.LimitVerbosity { + maxLen = ((1 << opts.verbosity()) >> 1) << 2 // 0, 4, 8, 16, 32, etc... + opts.VerbosityLevel-- + } + for i := 0; i < v.NumField(); i++ { + vv := v.Field(i) + if vv.IsZero() { + continue // Elide fields with zero values + } + if len(list) == maxLen { + list.AppendEllipsis(diffStats{}) + break + } + sf := t.Field(i) + if !isExported(sf.Name) { + vv = retrieveUnexportedField(v, sf, true) + } + s := opts.WithTypeMode(autoType).FormatValue(vv, t.Kind(), ptrs) + list = append(list, textRecord{Key: sf.Name, Value: s}) + } + return &textWrap{Prefix: "{", Value: list, Suffix: "}"} + case reflect.Slice: + if v.IsNil() { + return textNil + } + + // Check whether this is a []byte of text data. + if t.Elem() == byteType { + b := v.Bytes() + isPrintSpace := func(r rune) bool { return unicode.IsPrint(r) || unicode.IsSpace(r) } + if len(b) > 0 && utf8.Valid(b) && len(bytes.TrimFunc(b, isPrintSpace)) == 0 { + out = opts.formatString("", string(b)) + skipType = true + return opts.FormatType(t, out) + } + } + + fallthrough + case reflect.Array: + maxLen := v.Len() + if opts.LimitVerbosity { + maxLen = ((1 << opts.verbosity()) >> 1) << 2 // 0, 4, 8, 16, 32, etc... + opts.VerbosityLevel-- + } + var list textList + for i := 0; i < v.Len(); i++ { + if len(list) == maxLen { + list.AppendEllipsis(diffStats{}) + break + } + s := opts.WithTypeMode(elideType).FormatValue(v.Index(i), t.Kind(), ptrs) + list = append(list, textRecord{Value: s}) + } + + out = &textWrap{Prefix: "{", Value: list, Suffix: "}"} + if t.Kind() == reflect.Slice && opts.PrintAddresses { + header := fmt.Sprintf("ptr:%v, len:%d, cap:%d", formatPointer(value.PointerOf(v), false), v.Len(), v.Cap()) + out = &textWrap{Prefix: pointerDelimPrefix + header + pointerDelimSuffix, Value: out} + } + return out + case reflect.Map: + if v.IsNil() { + return textNil + } + + // Check pointer for cycles. + ptrRef, visited := ptrs.Push(v) + if visited { + return makeLeafReference(ptrRef, opts.PrintAddresses) + } + defer ptrs.Pop() + + maxLen := v.Len() + if opts.LimitVerbosity { + maxLen = ((1 << opts.verbosity()) >> 1) << 2 // 0, 4, 8, 16, 32, etc... + opts.VerbosityLevel-- + } + var list textList + for _, k := range value.SortKeys(v.MapKeys()) { + if len(list) == maxLen { + list.AppendEllipsis(diffStats{}) + break + } + sk := formatMapKey(k, false, ptrs) + sv := opts.WithTypeMode(elideType).FormatValue(v.MapIndex(k), t.Kind(), ptrs) + list = append(list, textRecord{Key: sk, Value: sv}) + } + + out = &textWrap{Prefix: "{", Value: list, Suffix: "}"} + out = wrapTrunkReference(ptrRef, opts.PrintAddresses, out) + return out + case reflect.Ptr: + if v.IsNil() { + return textNil + } + + // Check pointer for cycles. + ptrRef, visited := ptrs.Push(v) + if visited { + out = makeLeafReference(ptrRef, opts.PrintAddresses) + return &textWrap{Prefix: "&", Value: out} + } + defer ptrs.Pop() + + // Skip the name only if this is an unnamed pointer type. + // Otherwise taking the address of a value does not reproduce + // the named pointer type. + if v.Type().Name() == "" { + skipType = true // Let the underlying value print the type instead + } + out = opts.FormatValue(v.Elem(), t.Kind(), ptrs) + out = wrapTrunkReference(ptrRef, opts.PrintAddresses, out) + out = &textWrap{Prefix: "&", Value: out} + return out + case reflect.Interface: + if v.IsNil() { + return textNil + } + // Interfaces accept different concrete types, + // so configure the underlying value to explicitly print the type. + return opts.WithTypeMode(emitType).FormatValue(v.Elem(), t.Kind(), ptrs) + default: + panic(fmt.Sprintf("%v kind not handled", v.Kind())) + } +} + +func (opts formatOptions) formatString(prefix, s string) textNode { + maxLen := len(s) + maxLines := strings.Count(s, "\n") + 1 + if opts.LimitVerbosity { + maxLen = (1 << opts.verbosity()) << 5 // 32, 64, 128, 256, etc... + maxLines = (1 << opts.verbosity()) << 2 // 4, 8, 16, 32, 64, etc... + } + + // For multiline strings, use the triple-quote syntax, + // but only use it when printing removed or inserted nodes since + // we only want the extra verbosity for those cases. + lines := strings.Split(strings.TrimSuffix(s, "\n"), "\n") + isTripleQuoted := len(lines) >= 4 && (opts.DiffMode == '-' || opts.DiffMode == '+') + for i := 0; i < len(lines) && isTripleQuoted; i++ { + lines[i] = strings.TrimPrefix(strings.TrimSuffix(lines[i], "\r"), "\r") // trim leading/trailing carriage returns for legacy Windows endline support + isPrintable := func(r rune) bool { + return unicode.IsPrint(r) || r == '\t' // specially treat tab as printable + } + line := lines[i] + isTripleQuoted = !strings.HasPrefix(strings.TrimPrefix(line, prefix), `"""`) && !strings.HasPrefix(line, "...") && strings.TrimFunc(line, isPrintable) == "" && len(line) <= maxLen + } + if isTripleQuoted { + var list textList + list = append(list, textRecord{Diff: opts.DiffMode, Value: textLine(prefix + `"""`), ElideComma: true}) + for i, line := range lines { + if numElided := len(lines) - i; i == maxLines-1 && numElided > 1 { + comment := commentString(fmt.Sprintf("%d elided lines", numElided)) + list = append(list, textRecord{Diff: opts.DiffMode, Value: textEllipsis, ElideComma: true, Comment: comment}) + break + } + list = append(list, textRecord{Diff: opts.DiffMode, Value: textLine(line), ElideComma: true}) + } + list = append(list, textRecord{Diff: opts.DiffMode, Value: textLine(prefix + `"""`), ElideComma: true}) + return &textWrap{Prefix: "(", Value: list, Suffix: ")"} + } + + // Format the string as a single-line quoted string. + if len(s) > maxLen+len(textEllipsis) { + return textLine(prefix + formatString(s[:maxLen]) + string(textEllipsis)) + } + return textLine(prefix + formatString(s)) +} + +// formatMapKey formats v as if it were a map key. +// The result is guaranteed to be a single line. +func formatMapKey(v reflect.Value, disambiguate bool, ptrs *pointerReferences) string { + var opts formatOptions + opts.DiffMode = diffIdentical + opts.TypeMode = elideType + opts.PrintAddresses = disambiguate + opts.AvoidStringer = disambiguate + opts.QualifiedNames = disambiguate + opts.VerbosityLevel = maxVerbosityPreset + opts.LimitVerbosity = true + s := opts.FormatValue(v, reflect.Map, ptrs).String() + return strings.TrimSpace(s) +} + +// formatString prints s as a double-quoted or backtick-quoted string. +func formatString(s string) string { + // Use quoted string if it the same length as a raw string literal. + // Otherwise, attempt to use the raw string form. + qs := strconv.Quote(s) + if len(qs) == 1+len(s)+1 { + return qs + } + + // Disallow newlines to ensure output is a single line. + // Only allow printable runes for readability purposes. + rawInvalid := func(r rune) bool { + return r == '`' || r == '\n' || !(unicode.IsPrint(r) || r == '\t') + } + if utf8.ValidString(s) && strings.IndexFunc(s, rawInvalid) < 0 { + return "`" + s + "`" + } + return qs +} + +// formatHex prints u as a hexadecimal integer in Go notation. +func formatHex(u uint64) string { + var f string + switch { + case u <= 0xff: + f = "0x%02x" + case u <= 0xffff: + f = "0x%04x" + case u <= 0xffffff: + f = "0x%06x" + case u <= 0xffffffff: + f = "0x%08x" + case u <= 0xffffffffff: + f = "0x%010x" + case u <= 0xffffffffffff: + f = "0x%012x" + case u <= 0xffffffffffffff: + f = "0x%014x" + case u <= 0xffffffffffffffff: + f = "0x%016x" + } + return fmt.Sprintf(f, u) +} diff --git a/vendor/github.com/google/go-cmp/cmp/report_slices.go b/vendor/github.com/google/go-cmp/cmp/report_slices.go new file mode 100644 index 0000000..23e444f --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/report_slices.go @@ -0,0 +1,614 @@ +// Copyright 2019, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cmp + +import ( + "bytes" + "fmt" + "math" + "reflect" + "strconv" + "strings" + "unicode" + "unicode/utf8" + + "github.com/google/go-cmp/cmp/internal/diff" +) + +// CanFormatDiffSlice reports whether we support custom formatting for nodes +// that are slices of primitive kinds or strings. +func (opts formatOptions) CanFormatDiffSlice(v *valueNode) bool { + switch { + case opts.DiffMode != diffUnknown: + return false // Must be formatting in diff mode + case v.NumDiff == 0: + return false // No differences detected + case !v.ValueX.IsValid() || !v.ValueY.IsValid(): + return false // Both values must be valid + case v.NumIgnored > 0: + return false // Some ignore option was used + case v.NumTransformed > 0: + return false // Some transform option was used + case v.NumCompared > 1: + return false // More than one comparison was used + case v.NumCompared == 1 && v.Type.Name() != "": + // The need for cmp to check applicability of options on every element + // in a slice is a significant performance detriment for large []byte. + // The workaround is to specify Comparer(bytes.Equal), + // which enables cmp to compare []byte more efficiently. + // If they differ, we still want to provide batched diffing. + // The logic disallows named types since they tend to have their own + // String method, with nicer formatting than what this provides. + return false + } + + // Check whether this is an interface with the same concrete types. + t := v.Type + vx, vy := v.ValueX, v.ValueY + if t.Kind() == reflect.Interface && !vx.IsNil() && !vy.IsNil() && vx.Elem().Type() == vy.Elem().Type() { + vx, vy = vx.Elem(), vy.Elem() + t = vx.Type() + } + + // Check whether we provide specialized diffing for this type. + switch t.Kind() { + case reflect.String: + case reflect.Array, reflect.Slice: + // Only slices of primitive types have specialized handling. + switch t.Elem().Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64, + reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr, + reflect.Bool, reflect.Float32, reflect.Float64, reflect.Complex64, reflect.Complex128: + default: + return false + } + + // Both slice values have to be non-empty. + if t.Kind() == reflect.Slice && (vx.Len() == 0 || vy.Len() == 0) { + return false + } + + // If a sufficient number of elements already differ, + // use specialized formatting even if length requirement is not met. + if v.NumDiff > v.NumSame { + return true + } + default: + return false + } + + // Use specialized string diffing for longer slices or strings. + const minLength = 32 + return vx.Len() >= minLength && vy.Len() >= minLength +} + +// FormatDiffSlice prints a diff for the slices (or strings) represented by v. +// This provides custom-tailored logic to make printing of differences in +// textual strings and slices of primitive kinds more readable. +func (opts formatOptions) FormatDiffSlice(v *valueNode) textNode { + assert(opts.DiffMode == diffUnknown) + t, vx, vy := v.Type, v.ValueX, v.ValueY + if t.Kind() == reflect.Interface { + vx, vy = vx.Elem(), vy.Elem() + t = vx.Type() + opts = opts.WithTypeMode(emitType) + } + + // Auto-detect the type of the data. + var sx, sy string + var ssx, ssy []string + var isString, isMostlyText, isPureLinedText, isBinary bool + switch { + case t.Kind() == reflect.String: + sx, sy = vx.String(), vy.String() + isString = true + case t.Kind() == reflect.Slice && t.Elem() == byteType: + sx, sy = string(vx.Bytes()), string(vy.Bytes()) + isString = true + case t.Kind() == reflect.Array: + // Arrays need to be addressable for slice operations to work. + vx2, vy2 := reflect.New(t).Elem(), reflect.New(t).Elem() + vx2.Set(vx) + vy2.Set(vy) + vx, vy = vx2, vy2 + } + if isString { + var numTotalRunes, numValidRunes, numLines, lastLineIdx, maxLineLen int + for i, r := range sx + sy { + numTotalRunes++ + if (unicode.IsPrint(r) || unicode.IsSpace(r)) && r != utf8.RuneError { + numValidRunes++ + } + if r == '\n' { + if maxLineLen < i-lastLineIdx { + maxLineLen = i - lastLineIdx + } + lastLineIdx = i + 1 + numLines++ + } + } + isPureText := numValidRunes == numTotalRunes + isMostlyText = float64(numValidRunes) > math.Floor(0.90*float64(numTotalRunes)) + isPureLinedText = isPureText && numLines >= 4 && maxLineLen <= 1024 + isBinary = !isMostlyText + + // Avoid diffing by lines if it produces a significantly more complex + // edit script than diffing by bytes. + if isPureLinedText { + ssx = strings.Split(sx, "\n") + ssy = strings.Split(sy, "\n") + esLines := diff.Difference(len(ssx), len(ssy), func(ix, iy int) diff.Result { + return diff.BoolResult(ssx[ix] == ssy[iy]) + }) + esBytes := diff.Difference(len(sx), len(sy), func(ix, iy int) diff.Result { + return diff.BoolResult(sx[ix] == sy[iy]) + }) + efficiencyLines := float64(esLines.Dist()) / float64(len(esLines)) + efficiencyBytes := float64(esBytes.Dist()) / float64(len(esBytes)) + quotedLength := len(strconv.Quote(sx + sy)) + unquotedLength := len(sx) + len(sy) + escapeExpansionRatio := float64(quotedLength) / float64(unquotedLength) + isPureLinedText = efficiencyLines < 4*efficiencyBytes || escapeExpansionRatio > 1.1 + } + } + + // Format the string into printable records. + var list textList + var delim string + switch { + // If the text appears to be multi-lined text, + // then perform differencing across individual lines. + case isPureLinedText: + list = opts.formatDiffSlice( + reflect.ValueOf(ssx), reflect.ValueOf(ssy), 1, "line", + func(v reflect.Value, d diffMode) textRecord { + s := formatString(v.Index(0).String()) + return textRecord{Diff: d, Value: textLine(s)} + }, + ) + delim = "\n" + + // If possible, use a custom triple-quote (""") syntax for printing + // differences in a string literal. This format is more readable, + // but has edge-cases where differences are visually indistinguishable. + // This format is avoided under the following conditions: + // - A line starts with `"""` + // - A line starts with "..." + // - A line contains non-printable characters + // - Adjacent different lines differ only by whitespace + // + // For example: + // + // """ + // ... // 3 identical lines + // foo + // bar + // - baz + // + BAZ + // """ + isTripleQuoted := true + prevRemoveLines := map[string]bool{} + prevInsertLines := map[string]bool{} + var list2 textList + list2 = append(list2, textRecord{Value: textLine(`"""`), ElideComma: true}) + for _, r := range list { + if !r.Value.Equal(textEllipsis) { + line, _ := strconv.Unquote(string(r.Value.(textLine))) + line = strings.TrimPrefix(strings.TrimSuffix(line, "\r"), "\r") // trim leading/trailing carriage returns for legacy Windows endline support + normLine := strings.Map(func(r rune) rune { + if unicode.IsSpace(r) { + return -1 // drop whitespace to avoid visually indistinguishable output + } + return r + }, line) + isPrintable := func(r rune) bool { + return unicode.IsPrint(r) || r == '\t' // specially treat tab as printable + } + isTripleQuoted = !strings.HasPrefix(line, `"""`) && !strings.HasPrefix(line, "...") && strings.TrimFunc(line, isPrintable) == "" + switch r.Diff { + case diffRemoved: + isTripleQuoted = isTripleQuoted && !prevInsertLines[normLine] + prevRemoveLines[normLine] = true + case diffInserted: + isTripleQuoted = isTripleQuoted && !prevRemoveLines[normLine] + prevInsertLines[normLine] = true + } + if !isTripleQuoted { + break + } + r.Value = textLine(line) + r.ElideComma = true + } + if !(r.Diff == diffRemoved || r.Diff == diffInserted) { // start a new non-adjacent difference group + prevRemoveLines = map[string]bool{} + prevInsertLines = map[string]bool{} + } + list2 = append(list2, r) + } + if r := list2[len(list2)-1]; r.Diff == diffIdentical && len(r.Value.(textLine)) == 0 { + list2 = list2[:len(list2)-1] // elide single empty line at the end + } + list2 = append(list2, textRecord{Value: textLine(`"""`), ElideComma: true}) + if isTripleQuoted { + var out textNode = &textWrap{Prefix: "(", Value: list2, Suffix: ")"} + switch t.Kind() { + case reflect.String: + if t != stringType { + out = opts.FormatType(t, out) + } + case reflect.Slice: + // Always emit type for slices since the triple-quote syntax + // looks like a string (not a slice). + opts = opts.WithTypeMode(emitType) + out = opts.FormatType(t, out) + } + return out + } + + // If the text appears to be single-lined text, + // then perform differencing in approximately fixed-sized chunks. + // The output is printed as quoted strings. + case isMostlyText: + list = opts.formatDiffSlice( + reflect.ValueOf(sx), reflect.ValueOf(sy), 64, "byte", + func(v reflect.Value, d diffMode) textRecord { + s := formatString(v.String()) + return textRecord{Diff: d, Value: textLine(s)} + }, + ) + + // If the text appears to be binary data, + // then perform differencing in approximately fixed-sized chunks. + // The output is inspired by hexdump. + case isBinary: + list = opts.formatDiffSlice( + reflect.ValueOf(sx), reflect.ValueOf(sy), 16, "byte", + func(v reflect.Value, d diffMode) textRecord { + var ss []string + for i := 0; i < v.Len(); i++ { + ss = append(ss, formatHex(v.Index(i).Uint())) + } + s := strings.Join(ss, ", ") + comment := commentString(fmt.Sprintf("%c|%v|", d, formatASCII(v.String()))) + return textRecord{Diff: d, Value: textLine(s), Comment: comment} + }, + ) + + // For all other slices of primitive types, + // then perform differencing in approximately fixed-sized chunks. + // The size of each chunk depends on the width of the element kind. + default: + var chunkSize int + if t.Elem().Kind() == reflect.Bool { + chunkSize = 16 + } else { + switch t.Elem().Bits() { + case 8: + chunkSize = 16 + case 16: + chunkSize = 12 + case 32: + chunkSize = 8 + default: + chunkSize = 8 + } + } + list = opts.formatDiffSlice( + vx, vy, chunkSize, t.Elem().Kind().String(), + func(v reflect.Value, d diffMode) textRecord { + var ss []string + for i := 0; i < v.Len(); i++ { + switch t.Elem().Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + ss = append(ss, fmt.Sprint(v.Index(i).Int())) + case reflect.Uint, reflect.Uint16, reflect.Uint32, reflect.Uint64: + ss = append(ss, fmt.Sprint(v.Index(i).Uint())) + case reflect.Uint8, reflect.Uintptr: + ss = append(ss, formatHex(v.Index(i).Uint())) + case reflect.Bool, reflect.Float32, reflect.Float64, reflect.Complex64, reflect.Complex128: + ss = append(ss, fmt.Sprint(v.Index(i).Interface())) + } + } + s := strings.Join(ss, ", ") + return textRecord{Diff: d, Value: textLine(s)} + }, + ) + } + + // Wrap the output with appropriate type information. + var out textNode = &textWrap{Prefix: "{", Value: list, Suffix: "}"} + if !isMostlyText { + // The "{...}" byte-sequence literal is not valid Go syntax for strings. + // Emit the type for extra clarity (e.g. "string{...}"). + if t.Kind() == reflect.String { + opts = opts.WithTypeMode(emitType) + } + return opts.FormatType(t, out) + } + switch t.Kind() { + case reflect.String: + out = &textWrap{Prefix: "strings.Join(", Value: out, Suffix: fmt.Sprintf(", %q)", delim)} + if t != stringType { + out = opts.FormatType(t, out) + } + case reflect.Slice: + out = &textWrap{Prefix: "bytes.Join(", Value: out, Suffix: fmt.Sprintf(", %q)", delim)} + if t != bytesType { + out = opts.FormatType(t, out) + } + } + return out +} + +// formatASCII formats s as an ASCII string. +// This is useful for printing binary strings in a semi-legible way. +func formatASCII(s string) string { + b := bytes.Repeat([]byte{'.'}, len(s)) + for i := 0; i < len(s); i++ { + if ' ' <= s[i] && s[i] <= '~' { + b[i] = s[i] + } + } + return string(b) +} + +func (opts formatOptions) formatDiffSlice( + vx, vy reflect.Value, chunkSize int, name string, + makeRec func(reflect.Value, diffMode) textRecord, +) (list textList) { + eq := func(ix, iy int) bool { + return vx.Index(ix).Interface() == vy.Index(iy).Interface() + } + es := diff.Difference(vx.Len(), vy.Len(), func(ix, iy int) diff.Result { + return diff.BoolResult(eq(ix, iy)) + }) + + appendChunks := func(v reflect.Value, d diffMode) int { + n0 := v.Len() + for v.Len() > 0 { + n := chunkSize + if n > v.Len() { + n = v.Len() + } + list = append(list, makeRec(v.Slice(0, n), d)) + v = v.Slice(n, v.Len()) + } + return n0 - v.Len() + } + + var numDiffs int + maxLen := -1 + if opts.LimitVerbosity { + maxLen = (1 << opts.verbosity()) << 2 // 4, 8, 16, 32, 64, etc... + opts.VerbosityLevel-- + } + + groups := coalesceAdjacentEdits(name, es) + groups = coalesceInterveningIdentical(groups, chunkSize/4) + groups = cleanupSurroundingIdentical(groups, eq) + maxGroup := diffStats{Name: name} + for i, ds := range groups { + if maxLen >= 0 && numDiffs >= maxLen { + maxGroup = maxGroup.Append(ds) + continue + } + + // Print equal. + if ds.NumDiff() == 0 { + // Compute the number of leading and trailing equal bytes to print. + var numLo, numHi int + numEqual := ds.NumIgnored + ds.NumIdentical + for numLo < chunkSize*numContextRecords && numLo+numHi < numEqual && i != 0 { + numLo++ + } + for numHi < chunkSize*numContextRecords && numLo+numHi < numEqual && i != len(groups)-1 { + numHi++ + } + if numEqual-(numLo+numHi) <= chunkSize && ds.NumIgnored == 0 { + numHi = numEqual - numLo // Avoid pointless coalescing of single equal row + } + + // Print the equal bytes. + appendChunks(vx.Slice(0, numLo), diffIdentical) + if numEqual > numLo+numHi { + ds.NumIdentical -= numLo + numHi + list.AppendEllipsis(ds) + } + appendChunks(vx.Slice(numEqual-numHi, numEqual), diffIdentical) + vx = vx.Slice(numEqual, vx.Len()) + vy = vy.Slice(numEqual, vy.Len()) + continue + } + + // Print unequal. + len0 := len(list) + nx := appendChunks(vx.Slice(0, ds.NumIdentical+ds.NumRemoved+ds.NumModified), diffRemoved) + vx = vx.Slice(nx, vx.Len()) + ny := appendChunks(vy.Slice(0, ds.NumIdentical+ds.NumInserted+ds.NumModified), diffInserted) + vy = vy.Slice(ny, vy.Len()) + numDiffs += len(list) - len0 + } + if maxGroup.IsZero() { + assert(vx.Len() == 0 && vy.Len() == 0) + } else { + list.AppendEllipsis(maxGroup) + } + return list +} + +// coalesceAdjacentEdits coalesces the list of edits into groups of adjacent +// equal or unequal counts. +// +// Example: +// +// Input: "..XXY...Y" +// Output: [ +// {NumIdentical: 2}, +// {NumRemoved: 2, NumInserted 1}, +// {NumIdentical: 3}, +// {NumInserted: 1}, +// ] +func coalesceAdjacentEdits(name string, es diff.EditScript) (groups []diffStats) { + var prevMode byte + lastStats := func(mode byte) *diffStats { + if prevMode != mode { + groups = append(groups, diffStats{Name: name}) + prevMode = mode + } + return &groups[len(groups)-1] + } + for _, e := range es { + switch e { + case diff.Identity: + lastStats('=').NumIdentical++ + case diff.UniqueX: + lastStats('!').NumRemoved++ + case diff.UniqueY: + lastStats('!').NumInserted++ + case diff.Modified: + lastStats('!').NumModified++ + } + } + return groups +} + +// coalesceInterveningIdentical coalesces sufficiently short (<= windowSize) +// equal groups into adjacent unequal groups that currently result in a +// dual inserted/removed printout. This acts as a high-pass filter to smooth +// out high-frequency changes within the windowSize. +// +// Example: +// +// WindowSize: 16, +// Input: [ +// {NumIdentical: 61}, // group 0 +// {NumRemoved: 3, NumInserted: 1}, // group 1 +// {NumIdentical: 6}, // ├── coalesce +// {NumInserted: 2}, // ├── coalesce +// {NumIdentical: 1}, // ├── coalesce +// {NumRemoved: 9}, // └── coalesce +// {NumIdentical: 64}, // group 2 +// {NumRemoved: 3, NumInserted: 1}, // group 3 +// {NumIdentical: 6}, // ├── coalesce +// {NumInserted: 2}, // ├── coalesce +// {NumIdentical: 1}, // ├── coalesce +// {NumRemoved: 7}, // ├── coalesce +// {NumIdentical: 1}, // ├── coalesce +// {NumRemoved: 2}, // └── coalesce +// {NumIdentical: 63}, // group 4 +// ] +// Output: [ +// {NumIdentical: 61}, +// {NumIdentical: 7, NumRemoved: 12, NumInserted: 3}, +// {NumIdentical: 64}, +// {NumIdentical: 8, NumRemoved: 12, NumInserted: 3}, +// {NumIdentical: 63}, +// ] +func coalesceInterveningIdentical(groups []diffStats, windowSize int) []diffStats { + groups, groupsOrig := groups[:0], groups + for i, ds := range groupsOrig { + if len(groups) >= 2 && ds.NumDiff() > 0 { + prev := &groups[len(groups)-2] // Unequal group + curr := &groups[len(groups)-1] // Equal group + next := &groupsOrig[i] // Unequal group + hadX, hadY := prev.NumRemoved > 0, prev.NumInserted > 0 + hasX, hasY := next.NumRemoved > 0, next.NumInserted > 0 + if ((hadX || hasX) && (hadY || hasY)) && curr.NumIdentical <= windowSize { + *prev = prev.Append(*curr).Append(*next) + groups = groups[:len(groups)-1] // Truncate off equal group + continue + } + } + groups = append(groups, ds) + } + return groups +} + +// cleanupSurroundingIdentical scans through all unequal groups, and +// moves any leading sequence of equal elements to the preceding equal group and +// moves and trailing sequence of equal elements to the succeeding equal group. +// +// This is necessary since coalesceInterveningIdentical may coalesce edit groups +// together such that leading/trailing spans of equal elements becomes possible. +// Note that this can occur even with an optimal diffing algorithm. +// +// Example: +// +// Input: [ +// {NumIdentical: 61}, +// {NumIdentical: 1 , NumRemoved: 11, NumInserted: 2}, // assume 3 leading identical elements +// {NumIdentical: 67}, +// {NumIdentical: 7, NumRemoved: 12, NumInserted: 3}, // assume 10 trailing identical elements +// {NumIdentical: 54}, +// ] +// Output: [ +// {NumIdentical: 64}, // incremented by 3 +// {NumRemoved: 9}, +// {NumIdentical: 67}, +// {NumRemoved: 9}, +// {NumIdentical: 64}, // incremented by 10 +// ] +func cleanupSurroundingIdentical(groups []diffStats, eq func(i, j int) bool) []diffStats { + var ix, iy int // indexes into sequence x and y + for i, ds := range groups { + // Handle equal group. + if ds.NumDiff() == 0 { + ix += ds.NumIdentical + iy += ds.NumIdentical + continue + } + + // Handle unequal group. + nx := ds.NumIdentical + ds.NumRemoved + ds.NumModified + ny := ds.NumIdentical + ds.NumInserted + ds.NumModified + var numLeadingIdentical, numTrailingIdentical int + for j := 0; j < nx && j < ny && eq(ix+j, iy+j); j++ { + numLeadingIdentical++ + } + for j := 0; j < nx && j < ny && eq(ix+nx-1-j, iy+ny-1-j); j++ { + numTrailingIdentical++ + } + if numIdentical := numLeadingIdentical + numTrailingIdentical; numIdentical > 0 { + if numLeadingIdentical > 0 { + // Remove leading identical span from this group and + // insert it into the preceding group. + if i-1 >= 0 { + groups[i-1].NumIdentical += numLeadingIdentical + } else { + // No preceding group exists, so prepend a new group, + // but do so after we finish iterating over all groups. + defer func() { + groups = append([]diffStats{{Name: groups[0].Name, NumIdentical: numLeadingIdentical}}, groups...) + }() + } + // Increment indexes since the preceding group would have handled this. + ix += numLeadingIdentical + iy += numLeadingIdentical + } + if numTrailingIdentical > 0 { + // Remove trailing identical span from this group and + // insert it into the succeeding group. + if i+1 < len(groups) { + groups[i+1].NumIdentical += numTrailingIdentical + } else { + // No succeeding group exists, so append a new group, + // but do so after we finish iterating over all groups. + defer func() { + groups = append(groups, diffStats{Name: groups[len(groups)-1].Name, NumIdentical: numTrailingIdentical}) + }() + } + // Do not increment indexes since the succeeding group will handle this. + } + + // Update this group since some identical elements were removed. + nx -= numIdentical + ny -= numIdentical + groups[i] = diffStats{Name: ds.Name, NumRemoved: nx, NumInserted: ny} + } + ix += nx + iy += ny + } + return groups +} diff --git a/vendor/github.com/google/go-cmp/cmp/report_text.go b/vendor/github.com/google/go-cmp/cmp/report_text.go new file mode 100644 index 0000000..388fcf5 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/report_text.go @@ -0,0 +1,432 @@ +// Copyright 2019, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cmp + +import ( + "bytes" + "fmt" + "math/rand" + "strings" + "time" + "unicode/utf8" + + "github.com/google/go-cmp/cmp/internal/flags" +) + +var randBool = rand.New(rand.NewSource(time.Now().Unix())).Intn(2) == 0 + +const maxColumnLength = 80 + +type indentMode int + +func (n indentMode) appendIndent(b []byte, d diffMode) []byte { + // The output of Diff is documented as being unstable to provide future + // flexibility in changing the output for more humanly readable reports. + // This logic intentionally introduces instability to the exact output + // so that users can detect accidental reliance on stability early on, + // rather than much later when an actual change to the format occurs. + if flags.Deterministic || randBool { + // Use regular spaces (U+0020). + switch d { + case diffUnknown, diffIdentical: + b = append(b, " "...) + case diffRemoved: + b = append(b, "- "...) + case diffInserted: + b = append(b, "+ "...) + } + } else { + // Use non-breaking spaces (U+00a0). + switch d { + case diffUnknown, diffIdentical: + b = append(b, "  "...) + case diffRemoved: + b = append(b, "- "...) + case diffInserted: + b = append(b, "+ "...) + } + } + return repeatCount(n).appendChar(b, '\t') +} + +type repeatCount int + +func (n repeatCount) appendChar(b []byte, c byte) []byte { + for ; n > 0; n-- { + b = append(b, c) + } + return b +} + +// textNode is a simplified tree-based representation of structured text. +// Possible node types are textWrap, textList, or textLine. +type textNode interface { + // Len reports the length in bytes of a single-line version of the tree. + // Nested textRecord.Diff and textRecord.Comment fields are ignored. + Len() int + // Equal reports whether the two trees are structurally identical. + // Nested textRecord.Diff and textRecord.Comment fields are compared. + Equal(textNode) bool + // String returns the string representation of the text tree. + // It is not guaranteed that len(x.String()) == x.Len(), + // nor that x.String() == y.String() implies that x.Equal(y). + String() string + + // formatCompactTo formats the contents of the tree as a single-line string + // to the provided buffer. Any nested textRecord.Diff and textRecord.Comment + // fields are ignored. + // + // However, not all nodes in the tree should be collapsed as a single-line. + // If a node can be collapsed as a single-line, it is replaced by a textLine + // node. Since the top-level node cannot replace itself, this also returns + // the current node itself. + // + // This does not mutate the receiver. + formatCompactTo([]byte, diffMode) ([]byte, textNode) + // formatExpandedTo formats the contents of the tree as a multi-line string + // to the provided buffer. In order for column alignment to operate well, + // formatCompactTo must be called before calling formatExpandedTo. + formatExpandedTo([]byte, diffMode, indentMode) []byte +} + +// textWrap is a wrapper that concatenates a prefix and/or a suffix +// to the underlying node. +type textWrap struct { + Prefix string // e.g., "bytes.Buffer{" + Value textNode // textWrap | textList | textLine + Suffix string // e.g., "}" + Metadata interface{} // arbitrary metadata; has no effect on formatting +} + +func (s *textWrap) Len() int { + return len(s.Prefix) + s.Value.Len() + len(s.Suffix) +} +func (s1 *textWrap) Equal(s2 textNode) bool { + if s2, ok := s2.(*textWrap); ok { + return s1.Prefix == s2.Prefix && s1.Value.Equal(s2.Value) && s1.Suffix == s2.Suffix + } + return false +} +func (s *textWrap) String() string { + var d diffMode + var n indentMode + _, s2 := s.formatCompactTo(nil, d) + b := n.appendIndent(nil, d) // Leading indent + b = s2.formatExpandedTo(b, d, n) // Main body + b = append(b, '\n') // Trailing newline + return string(b) +} +func (s *textWrap) formatCompactTo(b []byte, d diffMode) ([]byte, textNode) { + n0 := len(b) // Original buffer length + b = append(b, s.Prefix...) + b, s.Value = s.Value.formatCompactTo(b, d) + b = append(b, s.Suffix...) + if _, ok := s.Value.(textLine); ok { + return b, textLine(b[n0:]) + } + return b, s +} +func (s *textWrap) formatExpandedTo(b []byte, d diffMode, n indentMode) []byte { + b = append(b, s.Prefix...) + b = s.Value.formatExpandedTo(b, d, n) + b = append(b, s.Suffix...) + return b +} + +// textList is a comma-separated list of textWrap or textLine nodes. +// The list may be formatted as multi-lines or single-line at the discretion +// of the textList.formatCompactTo method. +type textList []textRecord +type textRecord struct { + Diff diffMode // e.g., 0 or '-' or '+' + Key string // e.g., "MyField" + Value textNode // textWrap | textLine + ElideComma bool // avoid trailing comma + Comment fmt.Stringer // e.g., "6 identical fields" +} + +// AppendEllipsis appends a new ellipsis node to the list if none already +// exists at the end. If cs is non-zero it coalesces the statistics with the +// previous diffStats. +func (s *textList) AppendEllipsis(ds diffStats) { + hasStats := !ds.IsZero() + if len(*s) == 0 || !(*s)[len(*s)-1].Value.Equal(textEllipsis) { + if hasStats { + *s = append(*s, textRecord{Value: textEllipsis, ElideComma: true, Comment: ds}) + } else { + *s = append(*s, textRecord{Value: textEllipsis, ElideComma: true}) + } + return + } + if hasStats { + (*s)[len(*s)-1].Comment = (*s)[len(*s)-1].Comment.(diffStats).Append(ds) + } +} + +func (s textList) Len() (n int) { + for i, r := range s { + n += len(r.Key) + if r.Key != "" { + n += len(": ") + } + n += r.Value.Len() + if i < len(s)-1 { + n += len(", ") + } + } + return n +} + +func (s1 textList) Equal(s2 textNode) bool { + if s2, ok := s2.(textList); ok { + if len(s1) != len(s2) { + return false + } + for i := range s1 { + r1, r2 := s1[i], s2[i] + if !(r1.Diff == r2.Diff && r1.Key == r2.Key && r1.Value.Equal(r2.Value) && r1.Comment == r2.Comment) { + return false + } + } + return true + } + return false +} + +func (s textList) String() string { + return (&textWrap{Prefix: "{", Value: s, Suffix: "}"}).String() +} + +func (s textList) formatCompactTo(b []byte, d diffMode) ([]byte, textNode) { + s = append(textList(nil), s...) // Avoid mutating original + + // Determine whether we can collapse this list as a single line. + n0 := len(b) // Original buffer length + var multiLine bool + for i, r := range s { + if r.Diff == diffInserted || r.Diff == diffRemoved { + multiLine = true + } + b = append(b, r.Key...) + if r.Key != "" { + b = append(b, ": "...) + } + b, s[i].Value = r.Value.formatCompactTo(b, d|r.Diff) + if _, ok := s[i].Value.(textLine); !ok { + multiLine = true + } + if r.Comment != nil { + multiLine = true + } + if i < len(s)-1 { + b = append(b, ", "...) + } + } + // Force multi-lined output when printing a removed/inserted node that + // is sufficiently long. + if (d == diffInserted || d == diffRemoved) && len(b[n0:]) > maxColumnLength { + multiLine = true + } + if !multiLine { + return b, textLine(b[n0:]) + } + return b, s +} + +func (s textList) formatExpandedTo(b []byte, d diffMode, n indentMode) []byte { + alignKeyLens := s.alignLens( + func(r textRecord) bool { + _, isLine := r.Value.(textLine) + return r.Key == "" || !isLine + }, + func(r textRecord) int { return utf8.RuneCountInString(r.Key) }, + ) + alignValueLens := s.alignLens( + func(r textRecord) bool { + _, isLine := r.Value.(textLine) + return !isLine || r.Value.Equal(textEllipsis) || r.Comment == nil + }, + func(r textRecord) int { return utf8.RuneCount(r.Value.(textLine)) }, + ) + + // Format lists of simple lists in a batched form. + // If the list is sequence of only textLine values, + // then batch multiple values on a single line. + var isSimple bool + for _, r := range s { + _, isLine := r.Value.(textLine) + isSimple = r.Diff == 0 && r.Key == "" && isLine && r.Comment == nil + if !isSimple { + break + } + } + if isSimple { + n++ + var batch []byte + emitBatch := func() { + if len(batch) > 0 { + b = n.appendIndent(append(b, '\n'), d) + b = append(b, bytes.TrimRight(batch, " ")...) + batch = batch[:0] + } + } + for _, r := range s { + line := r.Value.(textLine) + if len(batch)+len(line)+len(", ") > maxColumnLength { + emitBatch() + } + batch = append(batch, line...) + batch = append(batch, ", "...) + } + emitBatch() + n-- + return n.appendIndent(append(b, '\n'), d) + } + + // Format the list as a multi-lined output. + n++ + for i, r := range s { + b = n.appendIndent(append(b, '\n'), d|r.Diff) + if r.Key != "" { + b = append(b, r.Key+": "...) + } + b = alignKeyLens[i].appendChar(b, ' ') + + b = r.Value.formatExpandedTo(b, d|r.Diff, n) + if !r.ElideComma { + b = append(b, ',') + } + b = alignValueLens[i].appendChar(b, ' ') + + if r.Comment != nil { + b = append(b, " // "+r.Comment.String()...) + } + } + n-- + + return n.appendIndent(append(b, '\n'), d) +} + +func (s textList) alignLens( + skipFunc func(textRecord) bool, + lenFunc func(textRecord) int, +) []repeatCount { + var startIdx, endIdx, maxLen int + lens := make([]repeatCount, len(s)) + for i, r := range s { + if skipFunc(r) { + for j := startIdx; j < endIdx && j < len(s); j++ { + lens[j] = repeatCount(maxLen - lenFunc(s[j])) + } + startIdx, endIdx, maxLen = i+1, i+1, 0 + } else { + if maxLen < lenFunc(r) { + maxLen = lenFunc(r) + } + endIdx = i + 1 + } + } + for j := startIdx; j < endIdx && j < len(s); j++ { + lens[j] = repeatCount(maxLen - lenFunc(s[j])) + } + return lens +} + +// textLine is a single-line segment of text and is always a leaf node +// in the textNode tree. +type textLine []byte + +var ( + textNil = textLine("nil") + textEllipsis = textLine("...") +) + +func (s textLine) Len() int { + return len(s) +} +func (s1 textLine) Equal(s2 textNode) bool { + if s2, ok := s2.(textLine); ok { + return bytes.Equal([]byte(s1), []byte(s2)) + } + return false +} +func (s textLine) String() string { + return string(s) +} +func (s textLine) formatCompactTo(b []byte, d diffMode) ([]byte, textNode) { + return append(b, s...), s +} +func (s textLine) formatExpandedTo(b []byte, _ diffMode, _ indentMode) []byte { + return append(b, s...) +} + +type diffStats struct { + Name string + NumIgnored int + NumIdentical int + NumRemoved int + NumInserted int + NumModified int +} + +func (s diffStats) IsZero() bool { + s.Name = "" + return s == diffStats{} +} + +func (s diffStats) NumDiff() int { + return s.NumRemoved + s.NumInserted + s.NumModified +} + +func (s diffStats) Append(ds diffStats) diffStats { + assert(s.Name == ds.Name) + s.NumIgnored += ds.NumIgnored + s.NumIdentical += ds.NumIdentical + s.NumRemoved += ds.NumRemoved + s.NumInserted += ds.NumInserted + s.NumModified += ds.NumModified + return s +} + +// String prints a humanly-readable summary of coalesced records. +// +// Example: +// +// diffStats{Name: "Field", NumIgnored: 5}.String() => "5 ignored fields" +func (s diffStats) String() string { + var ss []string + var sum int + labels := [...]string{"ignored", "identical", "removed", "inserted", "modified"} + counts := [...]int{s.NumIgnored, s.NumIdentical, s.NumRemoved, s.NumInserted, s.NumModified} + for i, n := range counts { + if n > 0 { + ss = append(ss, fmt.Sprintf("%d %v", n, labels[i])) + } + sum += n + } + + // Pluralize the name (adjusting for some obscure English grammar rules). + name := s.Name + if sum > 1 { + name += "s" + if strings.HasSuffix(name, "ys") { + name = name[:len(name)-2] + "ies" // e.g., "entrys" => "entries" + } + } + + // Format the list according to English grammar (with Oxford comma). + switch n := len(ss); n { + case 0: + return "" + case 1, 2: + return strings.Join(ss, " and ") + " " + name + default: + return strings.Join(ss[:n-1], ", ") + ", and " + ss[n-1] + " " + name + } +} + +type commentString string + +func (s commentString) String() string { return string(s) } diff --git a/vendor/github.com/google/go-cmp/cmp/report_value.go b/vendor/github.com/google/go-cmp/cmp/report_value.go new file mode 100644 index 0000000..668d470 --- /dev/null +++ b/vendor/github.com/google/go-cmp/cmp/report_value.go @@ -0,0 +1,121 @@ +// Copyright 2019, The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cmp + +import "reflect" + +// valueNode represents a single node within a report, which is a +// structured representation of the value tree, containing information +// regarding which nodes are equal or not. +type valueNode struct { + parent *valueNode + + Type reflect.Type + ValueX reflect.Value + ValueY reflect.Value + + // NumSame is the number of leaf nodes that are equal. + // All descendants are equal only if NumDiff is 0. + NumSame int + // NumDiff is the number of leaf nodes that are not equal. + NumDiff int + // NumIgnored is the number of leaf nodes that are ignored. + NumIgnored int + // NumCompared is the number of leaf nodes that were compared + // using an Equal method or Comparer function. + NumCompared int + // NumTransformed is the number of non-leaf nodes that were transformed. + NumTransformed int + // NumChildren is the number of transitive descendants of this node. + // This counts from zero; thus, leaf nodes have no descendants. + NumChildren int + // MaxDepth is the maximum depth of the tree. This counts from zero; + // thus, leaf nodes have a depth of zero. + MaxDepth int + + // Records is a list of struct fields, slice elements, or map entries. + Records []reportRecord // If populated, implies Value is not populated + + // Value is the result of a transformation, pointer indirect, of + // type assertion. + Value *valueNode // If populated, implies Records is not populated + + // TransformerName is the name of the transformer. + TransformerName string // If non-empty, implies Value is populated +} +type reportRecord struct { + Key reflect.Value // Invalid for slice element + Value *valueNode +} + +func (parent *valueNode) PushStep(ps PathStep) (child *valueNode) { + vx, vy := ps.Values() + child = &valueNode{parent: parent, Type: ps.Type(), ValueX: vx, ValueY: vy} + switch s := ps.(type) { + case StructField: + assert(parent.Value == nil) + parent.Records = append(parent.Records, reportRecord{Key: reflect.ValueOf(s.Name()), Value: child}) + case SliceIndex: + assert(parent.Value == nil) + parent.Records = append(parent.Records, reportRecord{Value: child}) + case MapIndex: + assert(parent.Value == nil) + parent.Records = append(parent.Records, reportRecord{Key: s.Key(), Value: child}) + case Indirect: + assert(parent.Value == nil && parent.Records == nil) + parent.Value = child + case TypeAssertion: + assert(parent.Value == nil && parent.Records == nil) + parent.Value = child + case Transform: + assert(parent.Value == nil && parent.Records == nil) + parent.Value = child + parent.TransformerName = s.Name() + parent.NumTransformed++ + default: + assert(parent == nil) // Must be the root step + } + return child +} + +func (r *valueNode) Report(rs Result) { + assert(r.MaxDepth == 0) // May only be called on leaf nodes + + if rs.ByIgnore() { + r.NumIgnored++ + } else { + if rs.Equal() { + r.NumSame++ + } else { + r.NumDiff++ + } + } + assert(r.NumSame+r.NumDiff+r.NumIgnored == 1) + + if rs.ByMethod() { + r.NumCompared++ + } + if rs.ByFunc() { + r.NumCompared++ + } + assert(r.NumCompared <= 1) +} + +func (child *valueNode) PopStep() (parent *valueNode) { + if child.parent == nil { + return nil + } + parent = child.parent + parent.NumSame += child.NumSame + parent.NumDiff += child.NumDiff + parent.NumIgnored += child.NumIgnored + parent.NumCompared += child.NumCompared + parent.NumTransformed += child.NumTransformed + parent.NumChildren += child.NumChildren + 1 + if parent.MaxDepth < child.MaxDepth+1 { + parent.MaxDepth = child.MaxDepth + 1 + } + return parent +} diff --git a/vendor/github.com/valyala/bytebufferpool/.travis.yml b/vendor/github.com/valyala/bytebufferpool/.travis.yml new file mode 100644 index 0000000..6a6ec2e --- /dev/null +++ b/vendor/github.com/valyala/bytebufferpool/.travis.yml @@ -0,0 +1,15 @@ +language: go + +go: + - 1.6 + +script: + # build test for supported platforms + - GOOS=linux go build + - GOOS=darwin go build + - GOOS=freebsd go build + - GOOS=windows go build + - GOARCH=386 go build + + # run tests on a standard platform + - go test -v ./... diff --git a/vendor/github.com/valyala/bytebufferpool/LICENSE b/vendor/github.com/valyala/bytebufferpool/LICENSE new file mode 100644 index 0000000..f7c935c --- /dev/null +++ b/vendor/github.com/valyala/bytebufferpool/LICENSE @@ -0,0 +1,22 @@ +The MIT License (MIT) + +Copyright (c) 2016 Aliaksandr Valialkin, VertaMedia + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. + diff --git a/vendor/github.com/valyala/bytebufferpool/README.md b/vendor/github.com/valyala/bytebufferpool/README.md new file mode 100644 index 0000000..061357e --- /dev/null +++ b/vendor/github.com/valyala/bytebufferpool/README.md @@ -0,0 +1,21 @@ +[![Build Status](https://travis-ci.org/valyala/bytebufferpool.svg)](https://travis-ci.org/valyala/bytebufferpool) +[![GoDoc](https://godoc.org/github.com/valyala/bytebufferpool?status.svg)](http://godoc.org/github.com/valyala/bytebufferpool) +[![Go Report](http://goreportcard.com/badge/valyala/bytebufferpool)](http://goreportcard.com/report/valyala/bytebufferpool) + +# bytebufferpool + +An implementation of a pool of byte buffers with anti-memory-waste protection. + +The pool may waste limited amount of memory due to fragmentation. +This amount equals to the maximum total size of the byte buffers +in concurrent use. + +# Benchmark results +Currently bytebufferpool is fastest and most effective buffer pool written in Go. + +You can find results [here](https://omgnull.github.io/go-benchmark/buffer/). + +# bytebufferpool users + +* [fasthttp](https://github.com/valyala/fasthttp) +* [quicktemplate](https://github.com/valyala/quicktemplate) diff --git a/vendor/github.com/valyala/bytebufferpool/bytebuffer.go b/vendor/github.com/valyala/bytebufferpool/bytebuffer.go new file mode 100644 index 0000000..07a055a --- /dev/null +++ b/vendor/github.com/valyala/bytebufferpool/bytebuffer.go @@ -0,0 +1,111 @@ +package bytebufferpool + +import "io" + +// ByteBuffer provides byte buffer, which can be used for minimizing +// memory allocations. +// +// ByteBuffer may be used with functions appending data to the given []byte +// slice. See example code for details. +// +// Use Get for obtaining an empty byte buffer. +type ByteBuffer struct { + + // B is a byte buffer to use in append-like workloads. + // See example code for details. + B []byte +} + +// Len returns the size of the byte buffer. +func (b *ByteBuffer) Len() int { + return len(b.B) +} + +// ReadFrom implements io.ReaderFrom. +// +// The function appends all the data read from r to b. +func (b *ByteBuffer) ReadFrom(r io.Reader) (int64, error) { + p := b.B + nStart := int64(len(p)) + nMax := int64(cap(p)) + n := nStart + if nMax == 0 { + nMax = 64 + p = make([]byte, nMax) + } else { + p = p[:nMax] + } + for { + if n == nMax { + nMax *= 2 + bNew := make([]byte, nMax) + copy(bNew, p) + p = bNew + } + nn, err := r.Read(p[n:]) + n += int64(nn) + if err != nil { + b.B = p[:n] + n -= nStart + if err == io.EOF { + return n, nil + } + return n, err + } + } +} + +// WriteTo implements io.WriterTo. +func (b *ByteBuffer) WriteTo(w io.Writer) (int64, error) { + n, err := w.Write(b.B) + return int64(n), err +} + +// Bytes returns b.B, i.e. all the bytes accumulated in the buffer. +// +// The purpose of this function is bytes.Buffer compatibility. +func (b *ByteBuffer) Bytes() []byte { + return b.B +} + +// Write implements io.Writer - it appends p to ByteBuffer.B +func (b *ByteBuffer) Write(p []byte) (int, error) { + b.B = append(b.B, p...) + return len(p), nil +} + +// WriteByte appends the byte c to the buffer. +// +// The purpose of this function is bytes.Buffer compatibility. +// +// The function always returns nil. +func (b *ByteBuffer) WriteByte(c byte) error { + b.B = append(b.B, c) + return nil +} + +// WriteString appends s to ByteBuffer.B. +func (b *ByteBuffer) WriteString(s string) (int, error) { + b.B = append(b.B, s...) + return len(s), nil +} + +// Set sets ByteBuffer.B to p. +func (b *ByteBuffer) Set(p []byte) { + b.B = append(b.B[:0], p...) +} + +// SetString sets ByteBuffer.B to s. +func (b *ByteBuffer) SetString(s string) { + b.B = append(b.B[:0], s...) +} + +// String returns string representation of ByteBuffer.B. +func (b *ByteBuffer) String() string { + return string(b.B) +} + +// Reset makes ByteBuffer.B empty. +func (b *ByteBuffer) Reset() { + b.B = b.B[:0] +} diff --git a/vendor/github.com/valyala/bytebufferpool/doc.go b/vendor/github.com/valyala/bytebufferpool/doc.go new file mode 100644 index 0000000..e511b7c --- /dev/null +++ b/vendor/github.com/valyala/bytebufferpool/doc.go @@ -0,0 +1,7 @@ +// Package bytebufferpool implements a pool of byte buffers +// with anti-fragmentation protection. +// +// The pool may waste limited amount of memory due to fragmentation. +// This amount equals to the maximum total size of the byte buffers +// in concurrent use. +package bytebufferpool diff --git a/vendor/github.com/valyala/bytebufferpool/pool.go b/vendor/github.com/valyala/bytebufferpool/pool.go new file mode 100644 index 0000000..8bb4134 --- /dev/null +++ b/vendor/github.com/valyala/bytebufferpool/pool.go @@ -0,0 +1,151 @@ +package bytebufferpool + +import ( + "sort" + "sync" + "sync/atomic" +) + +const ( + minBitSize = 6 // 2**6=64 is a CPU cache line size + steps = 20 + + minSize = 1 << minBitSize + maxSize = 1 << (minBitSize + steps - 1) + + calibrateCallsThreshold = 42000 + maxPercentile = 0.95 +) + +// Pool represents byte buffer pool. +// +// Distinct pools may be used for distinct types of byte buffers. +// Properly determined byte buffer types with their own pools may help reducing +// memory waste. +type Pool struct { + calls [steps]uint64 + calibrating uint64 + + defaultSize uint64 + maxSize uint64 + + pool sync.Pool +} + +var defaultPool Pool + +// Get returns an empty byte buffer from the pool. +// +// Got byte buffer may be returned to the pool via Put call. +// This reduces the number of memory allocations required for byte buffer +// management. +func Get() *ByteBuffer { return defaultPool.Get() } + +// Get returns new byte buffer with zero length. +// +// The byte buffer may be returned to the pool via Put after the use +// in order to minimize GC overhead. +func (p *Pool) Get() *ByteBuffer { + v := p.pool.Get() + if v != nil { + return v.(*ByteBuffer) + } + return &ByteBuffer{ + B: make([]byte, 0, atomic.LoadUint64(&p.defaultSize)), + } +} + +// Put returns byte buffer to the pool. +// +// ByteBuffer.B mustn't be touched after returning it to the pool. +// Otherwise data races will occur. +func Put(b *ByteBuffer) { defaultPool.Put(b) } + +// Put releases byte buffer obtained via Get to the pool. +// +// The buffer mustn't be accessed after returning to the pool. +func (p *Pool) Put(b *ByteBuffer) { + idx := index(len(b.B)) + + if atomic.AddUint64(&p.calls[idx], 1) > calibrateCallsThreshold { + p.calibrate() + } + + maxSize := int(atomic.LoadUint64(&p.maxSize)) + if maxSize == 0 || cap(b.B) <= maxSize { + b.Reset() + p.pool.Put(b) + } +} + +func (p *Pool) calibrate() { + if !atomic.CompareAndSwapUint64(&p.calibrating, 0, 1) { + return + } + + a := make(callSizes, 0, steps) + var callsSum uint64 + for i := uint64(0); i < steps; i++ { + calls := atomic.SwapUint64(&p.calls[i], 0) + callsSum += calls + a = append(a, callSize{ + calls: calls, + size: minSize << i, + }) + } + sort.Sort(a) + + defaultSize := a[0].size + maxSize := defaultSize + + maxSum := uint64(float64(callsSum) * maxPercentile) + callsSum = 0 + for i := 0; i < steps; i++ { + if callsSum > maxSum { + break + } + callsSum += a[i].calls + size := a[i].size + if size > maxSize { + maxSize = size + } + } + + atomic.StoreUint64(&p.defaultSize, defaultSize) + atomic.StoreUint64(&p.maxSize, maxSize) + + atomic.StoreUint64(&p.calibrating, 0) +} + +type callSize struct { + calls uint64 + size uint64 +} + +type callSizes []callSize + +func (ci callSizes) Len() int { + return len(ci) +} + +func (ci callSizes) Less(i, j int) bool { + return ci[i].calls > ci[j].calls +} + +func (ci callSizes) Swap(i, j int) { + ci[i], ci[j] = ci[j], ci[i] +} + +func index(n int) int { + n-- + n >>= minBitSize + idx := 0 + for n > 0 { + n >>= 1 + idx++ + } + if idx >= steps { + idx = steps - 1 + } + return idx +} diff --git a/vendor/github.com/valyala/quicktemplate/.gitignore b/vendor/github.com/valyala/quicktemplate/.gitignore new file mode 100644 index 0000000..6e92f57 --- /dev/null +++ b/vendor/github.com/valyala/quicktemplate/.gitignore @@ -0,0 +1 @@ +tags diff --git a/vendor/github.com/valyala/quicktemplate/.travis.yml b/vendor/github.com/valyala/quicktemplate/.travis.yml new file mode 100644 index 0000000..13673f8 --- /dev/null +++ b/vendor/github.com/valyala/quicktemplate/.travis.yml @@ -0,0 +1,21 @@ +language: go + +go: + - 1.11.x + - 1.12.x + - 1.13.x + - 1.14.x + - tip + +before_install: + - go get -u github.com/valyala/quicktemplate/qtc + - go generate + +script: + # build test for supported platforms + - GOOS=linux go build + - GOOS=darwin go build + - GOOS=freebsd go build + + # run tests on a standard platform + - go test -v ./... diff --git a/vendor/github.com/valyala/quicktemplate/LICENSE b/vendor/github.com/valyala/quicktemplate/LICENSE new file mode 100644 index 0000000..f7c935c --- /dev/null +++ b/vendor/github.com/valyala/quicktemplate/LICENSE @@ -0,0 +1,22 @@ +The MIT License (MIT) + +Copyright (c) 2016 Aliaksandr Valialkin, VertaMedia + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. + diff --git a/vendor/github.com/valyala/quicktemplate/QuickTemplate.xml b/vendor/github.com/valyala/quicktemplate/QuickTemplate.xml new file mode 100644 index 0000000..700d55e --- /dev/null +++ b/vendor/github.com/valyala/quicktemplate/QuickTemplate.xml @@ -0,0 +1,16 @@ + + + + + + + + + + + \ No newline at end of file diff --git a/vendor/github.com/valyala/quicktemplate/README.md b/vendor/github.com/valyala/quicktemplate/README.md new file mode 100644 index 0000000..34bc45f --- /dev/null +++ b/vendor/github.com/valyala/quicktemplate/README.md @@ -0,0 +1,649 @@ +[![Build Status](https://travis-ci.org/valyala/quicktemplate.svg)](https://travis-ci.org/valyala/quicktemplate) +[![GoDoc](https://godoc.org/github.com/valyala/quicktemplate?status.svg)](http://godoc.org/github.com/valyala/quicktemplate) +[![Go Report Card](https://goreportcard.com/badge/github.com/valyala/quicktemplate)](https://goreportcard.com/report/github.com/valyala/quicktemplate) + +# quicktemplate + +A fast, powerful, yet easy to use template engine for Go. +Inspired by the [Mako templates](http://www.makotemplates.org/) philosophy. + +# Features + + * [Extremely fast](#performance-comparison-with-htmltemplate). + Templates are converted into Go code and then compiled. + * Quicktemplate syntax is very close to Go - there is no need to learn + yet another template language before starting to use quicktemplate. + * Almost all bugs are caught during template compilation, so production + suffers less from template-related bugs. + * Easy to use. See [quickstart](#quick-start) and [examples](https://github.com/valyala/quicktemplate/tree/master/examples) + for details. + * Powerful. Arbitrary Go code may be embedded into and mixed with templates. + Be careful with this power - do not query the database and/or external resources from + templates unless you miss the PHP way in Go :) This power is mostly for + arbitrary data transformations. + * Easy to use template inheritance powered by [Go interfaces](https://golang.org/doc/effective_go.html#interfaces). + See [this example](https://github.com/valyala/quicktemplate/tree/master/examples/basicserver) for details. + * Templates are compiled into a single binary, so there is no need to copy + template files to the server. + +# Drawbacks + + * Templates cannot be updated on the fly on the server, since they + are compiled into a single binary. + Take a look at [fasttemplate](https://github.com/valyala/fasttemplate) + if you need a fast template engine for simple dynamically updated templates. + [There are ways](https://www.reddit.com/r/golang/comments/f290ja/hot_reloading_with_quicktemplates_sqlc_and/) to dynamically update the templates during development. + +# Performance comparison with html/template + +Quicktemplate is more than 20x faster than [html/template](https://golang.org/pkg/html/template/). +The following simple template is used in the benchmark: + + * [html/template version](https://github.com/valyala/quicktemplate/blob/master/testdata/templates/bench.tpl) + * [quicktemplate version](https://github.com/valyala/quicktemplate/blob/master/testdata/templates/bench.qtpl) + +Benchmark results: + +``` +$ go test -bench='Benchmark(Quick|HTML)Template' -benchmem github.com/valyala/quicktemplate/tests +BenchmarkQuickTemplate1-4 10000000 120 ns/op 0 B/op 0 allocs/op +BenchmarkQuickTemplate10-4 3000000 441 ns/op 0 B/op 0 allocs/op +BenchmarkQuickTemplate100-4 300000 3945 ns/op 0 B/op 0 allocs/op +BenchmarkHTMLTemplate1-4 500000 2501 ns/op 752 B/op 23 allocs/op +BenchmarkHTMLTemplate10-4 100000 12442 ns/op 3521 B/op 117 allocs/op +BenchmarkHTMLTemplate100-4 10000 123392 ns/op 34498 B/op 1152 allocs/op +``` + +[goTemplateBenchmark](https://github.com/SlinSo/goTemplateBenchmark) compares QuickTemplate with numerous Go templating packages. QuickTemplate performs favorably. + +# Security + + * All template placeholders are HTML-escaped by default. + * Template placeholders for JSON strings prevent from ``-based + XSS attacks: + + ```qtpl + {% func FailedXSS() %} + + {% endfunc %} + ``` + +# Examples + +See [examples](https://github.com/valyala/quicktemplate/tree/master/examples). + +# Quick start + +First of all, install the `quicktemplate` package +and [quicktemplate compiler](https://github.com/valyala/quicktemplate/tree/master/qtc) (`qtc`): + +``` +go get -u github.com/valyala/quicktemplate +go get -u github.com/valyala/quicktemplate/qtc +``` + +If you using `go generate`, you just need put following into your `main.go` + +Important: please specify your own folder (-dir) to generate template file + +``` +//go:generate go get -u github.com/valyala/quicktemplate/qtc +//go:generate qtc -dir=app/views +``` + +Let's start with a minimal template example: + +```qtpl +All text outside function templates is treated as comments, +i.e. it is just ignored by quicktemplate compiler (`qtc`). It is for humans. + +Hello is a simple template function. +{% func Hello(name string) %} + Hello, {%s name %}! +{% endfunc %} +``` + +Save this file into a `templates` folder under the name `hello.qtpl` +and run `qtc` inside this folder. + +If everything went OK, `hello.qtpl.go` file should appear in the `templates` folder. +This file contains Go code for `hello.qtpl`. Let's use it! + +Create a file main.go outside `templates` folder and put the following +code there: + +```go +package main + +import ( + "fmt" + + "./templates" +) + +func main() { + fmt.Printf("%s\n", templates.Hello("Foo")) + fmt.Printf("%s\n", templates.Hello("Bar")) +} +``` + +Then issue `go run`. If everything went OK, you'll see something like this: + +``` + + Hello, Foo! + + + Hello, Bar! + +``` + +Let's create more a complex template which calls other template functions, +contains loops, conditions, breaks, continues and returns. +Put the following template into `templates/greetings.qtpl`: + +```qtpl + +Greetings greets up to 42 names. +It also greets John differently comparing to others. +{% func Greetings(names []string) %} + {% if len(names) == 0 %} + Nobody to greet :( + {% return %} + {% endif %} + + {% for i, name := range names %} + {% if i == 42 %} + I'm tired to greet so many people... + {% break %} + {% elseif name == "John" %} + {%= sayHi("Mr. " + name) %} + {% continue %} + {% else %} + {%= Hello(name) %} + {% endif %} + {% endfor %} +{% endfunc %} + +sayHi is unexported, since it starts with lowercase letter. +{% func sayHi(name string) %} + Hi, {%s name %} +{% endfunc %} + +Note that every template file may contain an arbitrary number +of template functions. For instance, this file contains Greetings and sayHi +functions. +``` + +Run `qtc` inside `templates` folder. Now the folder should contain +two files with Go code: `hello.qtpl.go` and `greetings.qtpl.go`. These files +form a single `templates` Go package. Template functions and other template +stuff is shared between template files located in the same folder. +So `Hello` template function may be used inside `greetings.qtpl` while +it is defined in `hello.qtpl`. +Moreover, the folder may contain ordinary Go files, so its contents may +be used inside templates and vice versa. +The package name inside template files may be overriden +with `{% package packageName %}`. + +Now put the following code into `main.go`: + +```go +package main + +import ( + "bytes" + "fmt" + + "./templates" +) + +func main() { + names := []string{"Kate", "Go", "John", "Brad"} + + // qtc creates Write* function for each template function. + // Such functions accept io.Writer as first parameter: + var buf bytes.Buffer + templates.WriteGreetings(&buf, names) + + fmt.Printf("buf=\n%s", buf.Bytes()) +} +``` + +Careful readers may notice different output tags were used in these +templates: `{%s name %}` and `{%= Hello(name) %}`. What's the difference? +The `{%s x %}` is used for printing HTML-safe strings, while `{%= F() %}` +is used for embedding template function calls. Quicktemplate supports also +other output tags: + + * `{%d int %}` and `{%dl int64 %}` `{%dul uint64 %}` for integers. + * `{%f float %}` for float64. + Floating point precision may be set via `{%f.precision float %}`. + For example, `{%f.2 1.2345 %}` outputs `1.23`. + * `{%z bytes %}` for byte slices. + * `{%q str %}` and `{%qz bytes %}` for JSON-compatible quoted strings. + * `{%j str %}` and `{%jz bytes %}` for embedding str into a JSON string. Unlike `{%q str %}`, + it doesn't quote the string. + * `{%u str %}` and `{%uz bytes %}` for [URL encoding](https://en.wikipedia.org/wiki/Percent-encoding) + the given str. + * `{%v anything %}` is equivalent to `%v` in [printf-like functions](https://golang.org/pkg/fmt/). + +All the output tags except `{%= F() %}` produce HTML-safe output, i.e. they +escape `<` to `<`, `>` to `>`, etc. If you don't want HTML-safe output, +then just put `=` after the tag. For example: `{%s= "

This h1 won't be escaped

" %}`. + +As you may notice `{%= F() %}` and `{%s= F() %}` produce the same output for `{% func F() %}`. +But the first one is optimized for speed - it avoids memory allocations and copies. +It is therefore recommended to stick to it when embedding template function calls. + +Additionally, the following extensions are supported for `{%= F() %}`: + + * `{%=h F() %}` produces html-escaped output. + * `{%=u F() %}` produces [URL-encoded](https://en.wikipedia.org/wiki/Percent-encoding) output. + * `{%=q F() %}` produces quoted json string. + * `{%=j F() %}` produces json string without quotes. + * `{%=uh F() %}` produces html-safe URL-encoded output. + * `{%=qh F() %}` produces html-safe quoted json string. + * `{%=jh F() %}` produces html-safe json string without quotes. + +All output tags except `{%= F() %}` family may contain arbitrary valid +Go expressions instead of just an identifier. For example: + +```qtpl +Import fmt for fmt.Sprintf() +{% import "fmt" %} + +FmtFunc uses fmt.Sprintf() inside output tag +{% func FmtFunc(s string) %} + {%s fmt.Sprintf("FmtFunc accepted %q string", s) %} +{% endfunc %} +``` + +There are other useful tags supported by quicktemplate: + + * `{% comment %}` + + ```qtpl + {% comment %} + This is a comment. It won't trap into the output. + It may contain {% arbitrary tags %}. They are just ignored. + {% endcomment %} + ``` + + * `{% plain %}` + + ```qtpl + {% plain %} + Tags will {% trap into %} the output {% unmodified %}. + Plain block may contain invalid and {% incomplete tags. + {% endplain %} + ``` + + * `{% collapsespace %}` + + ```qtpl + {% collapsespace %} +
+
space between lines
+ and {%s "tags" %} +
is collapsed into a single space + unless{% newline %}or{% space %}is used
+
+ {% endcollapsespace %} + ``` + + Is converted into: + + ``` +
space between lines
and tags
is collapsed into a single space unless + or is used
+ ``` + + * `{% stripspace %}` + + ```qtpl + {% stripspace %} +
+
space between lines
+ and {%s " tags" %} +
is removed unless{% newline %}or{% space %}is used
+
+ {% endstripspace %} + ``` + + Is converted into: + + ``` +
space between lines
and tags
is removed unless + or is used
+ ``` + + * It is possible removing whitespace before and after the tag by adding `-` after `{%` or prepending `%}` with `-`. For example: + + ```qtpl + var sum int + {%- for i := 1; i <= 3; i++ -%} + sum += {%d i %} + {%- endfor -%} + return sum + ``` + + Is converted into: + ``` + var sum int + sum += 1 + sum += 2 + sum += 3 + return sum + ``` + + * `{% switch %}`, `{% case %}` and `{% default %}`: + + + ```qtpl + 1 + 1 = + {% switch 1+1 %} + {% case 2 %} + 2? + {% case 42 %} + 42! + {% default %} + I don't know :( + {% endswitch %} + ``` + + * `{% code %}`: + + ```qtpl + {% code + // arbitrary Go code may be embedded here! + type FooArg struct { + Name string + Age int + } + %} + ``` + + * `{% package %}`: + + ```qtpl + Override default package name with the custom name + {% package customPackageName %} + ``` + + * `{% import %}`: + + ```qtpl + Import external packages. + {% import "foo/bar" %} + {% import ( + "foo" + bar "baz/baa" + ) %} + ``` + + * `{% cat "/path/to/file" %}`: + + ```qtpl + Cat emits the given file contents as a plaintext: + {% func passwords() %} + /etc/passwd contents: + {% cat "/etc/passwd" %} + {% endfunc %} + ``` + + * `{% interface %}`: + + ```qtpl + Interfaces allow powerful templates' inheritance + {% + interface Page { + Title() + Body(s string, n int) + Footer() + } + %} + + PrintPage prints Page + {% func PrintPage(p Page) %} + + {%= p.Title() %} + +
{%= p.Body("foo", 42) %}
+
{%= p.Footer() %}
+ + + {% endfunc %} + + Base page implementation + {% code + type BasePage struct { + TitleStr string + FooterStr string + } + %} + {% func (bp *BasePage) Title() %}{%s bp.TitleStr %}{% endfunc %} + {% func (bp *BasePage) Body(s string, n int) %} + s={%q s %}, n={%d n %} + {% endfunc %} + {% func (bp *BasePage) Footer() %}{%s bp.FooterStr %}{% endfunc %} + + Main page implementation + {% code + type MainPage struct { + // inherit from BasePage + BasePage + + // real body for main page + BodyStr string + } + %} + + Override only Body + Title and Footer are used from BasePage. + {% func (mp *MainPage) Body(s string, n int) %} +
+ main body: {%s mp.BodyStr %} +
+
+ base body: {%= mp.BasePage.Body(s, n) %} +
+ {% endfunc %} + ``` + + See [basicserver example](https://github.com/valyala/quicktemplate/tree/master/examples/basicserver) + for more details. + +# Performance optimization tips + + * Prefer calling `WriteFoo` instead of `Foo` when generating template output + for `{% func Foo() %}`. This avoids unnesessary memory allocation and a copy + for a `string` returned from `Foo()`. + + * Prefer `{%= Foo() %}` instead of `{%s= Foo() %}` when embedding + a function template `{% func Foo() %}`. Though both approaches generate + identical output, the first approach is optimized for speed. + + * Prefer using existing output tags instead of passing `fmt.Sprintf` + to `{%s %}`. For instance, use `{%d num %}` instead + of `{%s fmt.Sprintf("%d", num) %}`, because the first approach is optimized + for speed. + + * Prefer using specific output tags instead of generic output tag + `{%v %}`. For example, use `{%s str %}` instead of `{%v str %}`, since + specific output tags are optimized for speed. + + * Prefer creating custom function templates instead of composing complex + strings by hands before passing them to `{%s %}`. + For instance, the first approach is slower than the second one: + + ```qtpl + {% func Foo(n int) %} + {% code + // construct complex string + complexStr := "" + for i := 0; i < n; i++ { + complexStr += fmt.Sprintf("num %d,", i) + } + %} + complex string = {%s= complexStr %} + {% endfunc %} + ``` + + ```qtpl + {% func Foo(n int) %} + complex string = {%= complexStr(n) %} + {% endfunc %} + + // Wrap complexStr func into stripspace for stripping unnesessary space + // between tags and lines. + {% stripspace %} + {% func complexStr(n int) %} + {% for i := 0; i < n; i++ %} + num{% space %}{%d i %}{% newline %} + {% endfor %} + {% endfunc %} + {% endstripspace %} + ``` + + * Make sure that the `io.Writer` passed to `Write*` functions + is [buffered](https://golang.org/pkg/bufio/#Writer). + This will minimize the number of `write` + [syscalls](https://en.wikipedia.org/wiki/System_call), + which may be quite expensive. + + Note: There is no need to wrap [fasthttp.RequestCtx](https://godoc.org/github.com/valyala/fasthttp#RequestCtx) + into [bufio.Writer](https://golang.org/pkg/bufio/#Writer), since it is already buffered. + + * [Profile](http://blog.golang.org/profiling-go-programs) your programs + for memory allocations and fix the most demanding functions based on + the output of `go tool pprof --alloc_objects`. + +# Use cases + +While the main quicktemplate purpose is generating HTML, it may be used +for generating other data too. For example, JSON and XML marshalling may +be easily implemented with quicktemplate: + +```qtpl +{% code +type MarshalRow struct { + Msg string + N int +} + +type MarshalData struct { + Foo int + Bar string + Rows []MarshalRow +} +%} + +// JSON marshaling +{% stripspace %} +{% func (d *MarshalData) JSON() %} +{ + "Foo": {%d d.Foo %}, + "Bar": {%q= d.Bar %}, + "Rows":[ + {% for i, r := range d.Rows %} + { + "Msg": {%q= r.Msg %}, + "N": {%d r.N %} + } + {% if i + 1 < len(d.Rows) %},{% endif %} + {% endfor %} + ] +} +{% endfunc %} +{% endstripspace %} + +// XML marshalling +{% stripspace %} +{% func (d *MarshalData) XML() %} + + {%d d.Foo %} + {%s d.Bar %} + + {% for _, r := range d.Rows %} + + {%s r.Msg %} + {%d r.N %} + + {% endfor %} + + +{% endfunc %} +{% endstripspace %} +``` + +Usually, marshalling built with quicktemplate works faster than the marshalling +implemented via standard [encoding/json](https://golang.org/pkg/encoding/json/) +and [encoding/xml](https://golang.org/pkg/encoding/xml/). +See the corresponding benchmark results: + +``` +go test -bench=Marshal -benchmem github.com/valyala/quicktemplate/tests +BenchmarkMarshalJSONStd1-4 3000000 480 ns/op 8 B/op 1 allocs/op +BenchmarkMarshalJSONStd10-4 1000000 1842 ns/op 8 B/op 1 allocs/op +BenchmarkMarshalJSONStd100-4 100000 15820 ns/op 8 B/op 1 allocs/op +BenchmarkMarshalJSONStd1000-4 10000 159327 ns/op 59 B/op 1 allocs/op +BenchmarkMarshalJSONQuickTemplate1-4 10000000 162 ns/op 0 B/op 0 allocs/op +BenchmarkMarshalJSONQuickTemplate10-4 2000000 748 ns/op 0 B/op 0 allocs/op +BenchmarkMarshalJSONQuickTemplate100-4 200000 6572 ns/op 0 B/op 0 allocs/op +BenchmarkMarshalJSONQuickTemplate1000-4 20000 66784 ns/op 29 B/op 0 allocs/op +BenchmarkMarshalXMLStd1-4 1000000 1652 ns/op 2 B/op 2 allocs/op +BenchmarkMarshalXMLStd10-4 200000 7533 ns/op 11 B/op 11 allocs/op +BenchmarkMarshalXMLStd100-4 20000 65763 ns/op 195 B/op 101 allocs/op +BenchmarkMarshalXMLStd1000-4 2000 663373 ns/op 3522 B/op 1002 allocs/op +BenchmarkMarshalXMLQuickTemplate1-4 10000000 145 ns/op 0 B/op 0 allocs/op +BenchmarkMarshalXMLQuickTemplate10-4 3000000 597 ns/op 0 B/op 0 allocs/op +BenchmarkMarshalXMLQuickTemplate100-4 300000 5833 ns/op 0 B/op 0 allocs/op +BenchmarkMarshalXMLQuickTemplate1000-4 30000 53000 ns/op 32 B/op 0 allocs/op +``` + +# FAQ + + * *Why is the quicktemplate syntax incompatible with [html/template](https://golang.org/pkg/html/template/)?* + + Because `html/template` syntax isn't expressive enough for `quicktemplate`. + + * *What's the difference between quicktemplate and [ego](https://github.com/benbjohnson/ego)?* + + `Ego` is similar to `quicktemplate` in the sense it converts templates into Go code. + But it misses the following stuff, which makes `quicktemplate` so powerful + and easy to use: + + * Defining multiple function templates in a single template file. + * Embedding function templates inside other function templates. + * Template interfaces, inheritance and overriding. + See [this example](https://github.com/valyala/quicktemplate/tree/master/examples/basicserver) + for details. + * Top-level comments outside function templates. + * Template packages. + * Combining arbitrary Go files with template files in template packages. + * Performance optimizations. + + * *What's the difference between quicktemplate and [gorazor](https://github.com/sipin/gorazor)?* + + `Gorazor` is similar to `quicktemplate` in the sense it converts templates into Go code. + But it misses the following useful features: + + * Clear syntax instead of hard-to-understand magic stuff related + to template arguments, template inheritance and embedding function + templates into other templates. + +* *Is there a syntax highlighting for qtpl files?* + + Yes - see [this issue](https://github.com/valyala/quicktemplate/issues/19) for details. + If you are using JetBrains products (syntax highlighting and autocomplete): + * cd [JetBrains settings directory](https://intellij-support.jetbrains.com/hc/en-us/articles/206544519-Directories-used-by-the-IDE-to-store-settings-caches-plugins-and-logs) + * mkdir -p filetypes && cd filetypes + * curl https://raw.githubusercontent.com/valyala/quicktemplate/master/QuickTemplate.xml >> QuickTemplate.xml + * Restart your IDE + +* *I didn't find an answer for my question here.* + + Try exploring [these questions](https://github.com/valyala/quicktemplate/issues?q=label%3Aquestion). diff --git a/vendor/github.com/valyala/quicktemplate/bytebuffer.go b/vendor/github.com/valyala/quicktemplate/bytebuffer.go new file mode 100644 index 0000000..47d88f7 --- /dev/null +++ b/vendor/github.com/valyala/quicktemplate/bytebuffer.go @@ -0,0 +1,45 @@ +package quicktemplate + +import ( + "github.com/valyala/bytebufferpool" +) + +// ByteBuffer implements io.Writer on top of byte slice. +// +// Recycle byte buffers via AcquireByteBuffer and ReleaseByteBuffer +// in order to reduce memory allocations. +// +// Deprecated: use github.com/valyala/bytebufferpool instead. +type ByteBuffer bytebufferpool.ByteBuffer + +// Write implements io.Writer. +func (b *ByteBuffer) Write(p []byte) (int, error) { + return bb(b).Write(p) +} + +// Reset resets the byte buffer. +func (b *ByteBuffer) Reset() { + bb(b).Reset() +} + +// AcquireByteBuffer returns new ByteBuffer from the pool. +// +// Return unneeded buffers to the pool by calling ReleaseByteBuffer +// in order to reduce memory allocations. +func AcquireByteBuffer() *ByteBuffer { + return (*ByteBuffer)(byteBufferPool.Get()) +} + +// ReleaseByteBuffer retruns byte buffer to the pool. +// +// Do not access byte buffer after returning it to the pool, +// otherwise data races may occur. +func ReleaseByteBuffer(b *ByteBuffer) { + byteBufferPool.Put(bb(b)) +} + +func bb(b *ByteBuffer) *bytebufferpool.ByteBuffer { + return (*bytebufferpool.ByteBuffer)(b) +} + +var byteBufferPool bytebufferpool.Pool diff --git a/vendor/github.com/valyala/quicktemplate/doc.go b/vendor/github.com/valyala/quicktemplate/doc.go new file mode 100644 index 0000000..14cb5ff --- /dev/null +++ b/vendor/github.com/valyala/quicktemplate/doc.go @@ -0,0 +1,6 @@ +/* +Package quicktemplate provides fast and powerful template engine. + +See https://github.com/valyala/quicktemplate for details. +*/ +package quicktemplate diff --git a/vendor/github.com/valyala/quicktemplate/htmlescapewriter.go b/vendor/github.com/valyala/quicktemplate/htmlescapewriter.go new file mode 100644 index 0000000..77560b4 --- /dev/null +++ b/vendor/github.com/valyala/quicktemplate/htmlescapewriter.go @@ -0,0 +1,62 @@ +package quicktemplate + +import ( + "bytes" + "io" +) + +type htmlEscapeWriter struct { + w io.Writer +} + +func (w *htmlEscapeWriter) Write(b []byte) (int, error) { + if bytes.IndexByte(b, '<') < 0 && + bytes.IndexByte(b, '>') < 0 && + bytes.IndexByte(b, '"') < 0 && + bytes.IndexByte(b, '\'') < 0 && + bytes.IndexByte(b, '&') < 0 { + + // fast path - nothing to escape + return w.w.Write(b) + } + + // slow path + write := w.w.Write + j := 0 + for i, c := range b { + switch c { + case '<': + write(b[j:i]) + write(strLT) + j = i + 1 + case '>': + write(b[j:i]) + write(strGT) + j = i + 1 + case '"': + write(b[j:i]) + write(strQuot) + j = i + 1 + case '\'': + write(b[j:i]) + write(strApos) + j = i + 1 + case '&': + write(b[j:i]) + write(strAmp) + j = i + 1 + } + } + if n, err := write(b[j:]); err != nil { + return j + n, err + } + return len(b), nil +} + +var ( + strLT = []byte("<") + strGT = []byte(">") + strQuot = []byte(""") + strApos = []byte("'") + strAmp = []byte("&") +) diff --git a/vendor/github.com/valyala/quicktemplate/jsonstring.go b/vendor/github.com/valyala/quicktemplate/jsonstring.go new file mode 100644 index 0000000..9154770 --- /dev/null +++ b/vendor/github.com/valyala/quicktemplate/jsonstring.go @@ -0,0 +1,65 @@ +package quicktemplate + +import ( + "fmt" + "strings" +) + +func hasSpecialChars(s string) bool { + if strings.IndexByte(s, '"') >= 0 || strings.IndexByte(s, '\\') >= 0 || strings.IndexByte(s, '<') >= 0 || strings.IndexByte(s, '\'') >= 0 { + return true + } + for i := 0; i < len(s); i++ { + if s[i] < 0x20 { + return true + } + } + return false +} + +func appendJSONString(dst []byte, s string, addQuotes bool) []byte { + if !hasSpecialChars(s) { + // Fast path - nothing to escape. + if !addQuotes { + return append(dst, s...) + } + dst = append(dst, '"') + dst = append(dst, s...) + dst = append(dst, '"') + return dst + } + + // Slow path - there are chars to escape. + if addQuotes { + dst = append(dst, '"') + } + bb := AcquireByteBuffer() + var tmp []byte + tmp, bb.B = bb.B, dst + _, err := jsonReplacer.WriteString(bb, s) + if err != nil { + panic(fmt.Errorf("BUG: unexpected error returned from jsonReplacer.WriteString: %s", err)) + } + dst, bb.B = bb.B, tmp + ReleaseByteBuffer(bb) + if addQuotes { + dst = append(dst, '"') + } + return dst +} + +var jsonReplacer = strings.NewReplacer(func() []string { + a := []string{ + "\n", `\n`, + "\r", `\r`, + "\t", `\t`, + "\"", `\"`, + "\\", `\\`, + "<", `\u003c`, + "'", `\u0027`, + } + for i := 0; i < 0x20; i++ { + a = append(a, string([]byte{byte(i)}), fmt.Sprintf(`\u%04x`, i)) + } + return a +}()...) diff --git a/vendor/github.com/valyala/quicktemplate/urlencode.go b/vendor/github.com/valyala/quicktemplate/urlencode.go new file mode 100644 index 0000000..33113ba --- /dev/null +++ b/vendor/github.com/valyala/quicktemplate/urlencode.go @@ -0,0 +1,32 @@ +package quicktemplate + +func appendURLEncode(dst []byte, src string) []byte { + n := len(src) + if n > 0 { + // Hint the compiler to remove bounds checks in the loop below. + _ = src[n-1] + } + for i := 0; i < n; i++ { + c := src[i] + + // See http://www.w3.org/TR/html5/forms.html#form-submission-algorithm + if c >= 'a' && c <= 'z' || c >= 'A' && c <= 'Z' || c >= '0' && c <= '9' || + c == '-' || c == '.' || c == '_' { + dst = append(dst, c) + } else { + if c == ' ' { + dst = append(dst, '+') + } else { + dst = append(dst, '%', hexCharUpper(c>>4), hexCharUpper(c&15)) + } + } + } + return dst +} + +func hexCharUpper(c byte) byte { + if c < 10 { + return '0' + c + } + return c - 10 + 'A' +} diff --git a/vendor/github.com/valyala/quicktemplate/util.go b/vendor/github.com/valyala/quicktemplate/util.go new file mode 100644 index 0000000..8476ff5 --- /dev/null +++ b/vendor/github.com/valyala/quicktemplate/util.go @@ -0,0 +1,3 @@ +package quicktemplate + +//go:generate qtc -dir=testdata/templates diff --git a/vendor/github.com/valyala/quicktemplate/util_appengine.go b/vendor/github.com/valyala/quicktemplate/util_appengine.go new file mode 100644 index 0000000..7642bf7 --- /dev/null +++ b/vendor/github.com/valyala/quicktemplate/util_appengine.go @@ -0,0 +1,11 @@ +// +build appengine appenginevm + +package quicktemplate + +func unsafeStrToBytes(s string) []byte { + return []byte(s) +} + +func unsafeBytesToStr(z []byte) string { + return string(z) +} diff --git a/vendor/github.com/valyala/quicktemplate/util_noappengine.go b/vendor/github.com/valyala/quicktemplate/util_noappengine.go new file mode 100644 index 0000000..f4da7ff --- /dev/null +++ b/vendor/github.com/valyala/quicktemplate/util_noappengine.go @@ -0,0 +1,21 @@ +// +build !appengine,!appenginevm + +package quicktemplate + +import ( + "reflect" + "unsafe" +) + +func unsafeStrToBytes(s string) (b []byte) { + sh := (*reflect.StringHeader)(unsafe.Pointer(&s)) + bh := (*reflect.SliceHeader)(unsafe.Pointer(&b)) + bh.Data = sh.Data + bh.Len = sh.Len + bh.Cap = sh.Len + return b +} + +func unsafeBytesToStr(z []byte) string { + return *(*string)(unsafe.Pointer(&z)) +} diff --git a/vendor/github.com/valyala/quicktemplate/writer.go b/vendor/github.com/valyala/quicktemplate/writer.go new file mode 100644 index 0000000..b541dfd --- /dev/null +++ b/vendor/github.com/valyala/quicktemplate/writer.go @@ -0,0 +1,220 @@ +package quicktemplate + +import ( + "fmt" + "io" + "strconv" + "sync" +) + +// Writer implements auxiliary writer used by quicktemplate functions. +// +// Use AcquireWriter for creating new writers. +type Writer struct { + e QWriter + n QWriter +} + +// W returns the underlying writer passed to AcquireWriter. +func (qw *Writer) W() io.Writer { + return qw.n.w +} + +// E returns QWriter with enabled html escaping. +func (qw *Writer) E() *QWriter { + return &qw.e +} + +// N returns QWriter without html escaping. +func (qw *Writer) N() *QWriter { + return &qw.n +} + +// AcquireWriter returns new writer from the pool. +// +// Return unneeded writer to the pool by calling ReleaseWriter +// in order to reduce memory allocations. +func AcquireWriter(w io.Writer) *Writer { + v := writerPool.Get() + if v == nil { + qw := &Writer{} + qw.e.w = &htmlEscapeWriter{} + v = qw + } + qw := v.(*Writer) + qw.e.w.(*htmlEscapeWriter).w = w + qw.n.w = w + return qw +} + +// ReleaseWriter returns the writer to the pool. +// +// Do not access released writer, otherwise data races may occur. +func ReleaseWriter(qw *Writer) { + hw := qw.e.w.(*htmlEscapeWriter) + hw.w = nil + qw.e.Reset() + qw.e.w = hw + + qw.n.Reset() + + writerPool.Put(qw) +} + +var writerPool sync.Pool + +// QWriter is auxiliary writer used by Writer. +type QWriter struct { + w io.Writer + err error + b []byte +} + +// Write implements io.Writer. +func (w *QWriter) Write(p []byte) (int, error) { + if w.err != nil { + return 0, w.err + } + n, err := w.w.Write(p) + if err != nil { + w.err = err + } + return n, err +} + +// Reset resets QWriter to the original state. +func (w *QWriter) Reset() { + w.w = nil + w.err = nil +} + +// S writes s to w. +func (w *QWriter) S(s string) { + w.Write(unsafeStrToBytes(s)) +} + +// Z writes z to w. +func (w *QWriter) Z(z []byte) { + w.Write(z) +} + +// SZ is a synonym to Z. +func (w *QWriter) SZ(z []byte) { + w.Write(z) +} + +// D writes n to w. +func (w *QWriter) D(n int) { + bb, ok := w.w.(*ByteBuffer) + if ok { + bb.B = strconv.AppendInt(bb.B, int64(n), 10) + } else { + w.b = strconv.AppendInt(w.b[:0], int64(n), 10) + w.Write(w.b) + } +} + +// DL writes n to w +func (w *QWriter) DL(n int64) { + bb, ok := w.w.(*ByteBuffer) + if ok { + bb.B = strconv.AppendInt(bb.B, n, 10) + } else { + w.b = strconv.AppendInt(w.b[:0], n, 10) + w.Write(w.b) + } +} + +// DUL writes n to w +func (w *QWriter) DUL(n uint64) { + bb, ok := w.w.(*ByteBuffer) + if ok { + bb.B = strconv.AppendUint(bb.B, n, 10) + } else { + w.b = strconv.AppendUint(w.b[:0], n, 10) + w.Write(w.b) + } +} + +// F writes f to w. +func (w *QWriter) F(f float64) { + n := int(f) + if float64(n) == f { + // Fast path - just int. + w.D(n) + return + } + + // Slow path. + w.FPrec(f, -1) +} + +// FPrec writes f to w using the given floating point precision. +func (w *QWriter) FPrec(f float64, prec int) { + bb, ok := w.w.(*ByteBuffer) + if ok { + bb.B = strconv.AppendFloat(bb.B, f, 'f', prec, 64) + } else { + w.b = strconv.AppendFloat(w.b[:0], f, 'f', prec, 64) + w.Write(w.b) + } +} + +// Q writes quoted json-safe s to w. +func (w *QWriter) Q(s string) { + bb, ok := w.w.(*ByteBuffer) + if ok { + bb.B = appendJSONString(bb.B, s, true) + } else { + w.b = appendJSONString(w.b[:0], s, true) + w.Write(w.b) + } +} + +var strQuote = []byte(`"`) + +// QZ writes quoted json-safe z to w. +func (w *QWriter) QZ(z []byte) { + w.Q(unsafeBytesToStr(z)) +} + +// J writes json-safe s to w. +// +// Unlike Q it doesn't qoute resulting s. +func (w *QWriter) J(s string) { + bb, ok := w.w.(*ByteBuffer) + if ok { + bb.B = appendJSONString(bb.B, s, false) + } else { + w.b = appendJSONString(w.b[:0], s, false) + w.Write(w.b) + } +} + +// JZ writes json-safe z to w. +// +// Unlike Q it doesn't qoute resulting z. +func (w *QWriter) JZ(z []byte) { + w.J(unsafeBytesToStr(z)) +} + +// V writes v to w. +func (w *QWriter) V(v interface{}) { + fmt.Fprintf(w, "%v", v) +} + +// U writes url-encoded s to w. +func (w *QWriter) U(s string) { + bb, ok := w.w.(*ByteBuffer) + if ok { + bb.B = appendURLEncode(bb.B, s) + } else { + w.b = appendURLEncode(w.b[:0], s) + w.Write(w.b) + } +} + +// UZ writes url-encoded z to w. +func (w *QWriter) UZ(z []byte) { + w.U(unsafeBytesToStr(z)) +} diff --git a/vendor/golang.org/x/text/LICENSE b/vendor/golang.org/x/text/LICENSE new file mode 100644 index 0000000..6a66aea --- /dev/null +++ b/vendor/golang.org/x/text/LICENSE @@ -0,0 +1,27 @@ +Copyright (c) 2009 The Go Authors. All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/golang.org/x/text/PATENTS b/vendor/golang.org/x/text/PATENTS new file mode 100644 index 0000000..7330990 --- /dev/null +++ b/vendor/golang.org/x/text/PATENTS @@ -0,0 +1,22 @@ +Additional IP Rights Grant (Patents) + +"This implementation" means the copyrightable works distributed by +Google as part of the Go project. + +Google hereby grants to You a perpetual, worldwide, non-exclusive, +no-charge, royalty-free, irrevocable (except as stated in this section) +patent license to make, have made, use, offer to sell, sell, import, +transfer and otherwise run, modify and propagate the contents of this +implementation of Go, where such license applies only to those patent +claims, both currently owned or controlled by Google and acquired in +the future, licensable by Google that are necessarily infringed by this +implementation of Go. This grant does not include claims that would be +infringed only as a consequence of further modification of this +implementation. If you or your agent or exclusive licensee institute or +order or agree to the institution of patent litigation against any +entity (including a cross-claim or counterclaim in a lawsuit) alleging +that this implementation of Go or any code incorporated within this +implementation of Go constitutes direct or contributory patent +infringement, or inducement of patent infringement, then any patent +rights granted to you under this License for this implementation of Go +shall terminate as of the date such litigation is filed. diff --git a/vendor/golang.org/x/text/feature/plural/common.go b/vendor/golang.org/x/text/feature/plural/common.go new file mode 100644 index 0000000..fdcb373 --- /dev/null +++ b/vendor/golang.org/x/text/feature/plural/common.go @@ -0,0 +1,70 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package plural + +// Form defines a plural form. +// +// Not all languages support all forms. Also, the meaning of each form varies +// per language. It is important to note that the name of a form does not +// necessarily correspond one-to-one with the set of numbers. For instance, +// for Croation, One matches not only 1, but also 11, 21, etc. +// +// Each language must at least support the form "other". +type Form byte + +const ( + Other Form = iota + Zero + One + Two + Few + Many +) + +var countMap = map[string]Form{ + "other": Other, + "zero": Zero, + "one": One, + "two": Two, + "few": Few, + "many": Many, +} + +type pluralCheck struct { + // category: + // 3..7: opID + // 0..2: category + cat byte + setID byte +} + +// opID identifies the type of operand in the plural rule, being i, n or f. +// (v, w, and t are treated as filters in our implementation.) +type opID byte + +const ( + opMod opID = 0x1 // is '%' used? + opNotEqual opID = 0x2 // using "!=" to compare + opI opID = 0 << 2 // integers after taking the absolute value + opN opID = 1 << 2 // full number (must be integer) + opF opID = 2 << 2 // fraction + opV opID = 3 << 2 // number of visible digits + opW opID = 4 << 2 // number of visible digits without trailing zeros + opBretonM opID = 5 << 2 // hard-wired rule for Breton + opItalian800 opID = 6 << 2 // hard-wired rule for Italian + opAzerbaijan00s opID = 7 << 2 // hard-wired rule for Azerbaijan +) +const ( + // Use this plural form to indicate the next rule needs to match as well. + // The last condition in the list will have the correct plural form. + andNext = 0x7 + formMask = 0x7 + + opShift = 3 + + // numN indicates the maximum integer, or maximum mod value, for which we + // have inclusion masks. + numN = 100 + // The common denominator of the modulo that is taken. + maxMod = 100 +) diff --git a/vendor/golang.org/x/text/feature/plural/message.go b/vendor/golang.org/x/text/feature/plural/message.go new file mode 100644 index 0000000..56d518c --- /dev/null +++ b/vendor/golang.org/x/text/feature/plural/message.go @@ -0,0 +1,244 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package plural + +import ( + "fmt" + "io" + "reflect" + "strconv" + + "golang.org/x/text/internal/catmsg" + "golang.org/x/text/internal/number" + "golang.org/x/text/language" + "golang.org/x/text/message/catalog" +) + +// TODO: consider deleting this interface. Maybe VisibleDigits is always +// sufficient and practical. + +// Interface is used for types that can determine their own plural form. +type Interface interface { + // PluralForm reports the plural form for the given language of the + // underlying value. It also returns the integer value. If the integer value + // is larger than fits in n, PluralForm may return a value modulo + // 10,000,000. + PluralForm(t language.Tag, scale int) (f Form, n int) +} + +// Selectf returns the first case for which its selector is a match for the +// arg-th substitution argument to a formatting call, formatting it as indicated +// by format. +// +// The cases argument are pairs of selectors and messages. Selectors are of type +// string or Form. Messages are of type string or catalog.Message. A selector +// matches an argument if: +// - it is "other" or Other +// - it matches the plural form of the argument: "zero", "one", "two", "few", +// or "many", or the equivalent Form +// - it is of the form "=x" where x is an integer that matches the value of +// the argument. +// - it is of the form " kindDefault { + e.EncodeUint(uint64(m.scale)) + } + + forms := validForms(cardinal, e.Language()) + + for i := 0; i < len(m.cases); { + if err := compileSelector(e, forms, m.cases[i]); err != nil { + return err + } + if i++; i >= len(m.cases) { + return fmt.Errorf("plural: no message defined for selector %v", m.cases[i-1]) + } + var msg catalog.Message + switch x := m.cases[i].(type) { + case string: + msg = catalog.String(x) + case catalog.Message: + msg = x + default: + return fmt.Errorf("plural: message of type %T; must be string or catalog.Message", x) + } + if err := e.EncodeMessage(msg); err != nil { + return err + } + i++ + } + return nil +} + +func compileSelector(e *catmsg.Encoder, valid []Form, selector interface{}) error { + form := Other + switch x := selector.(type) { + case string: + if x == "" { + return fmt.Errorf("plural: empty selector") + } + if c := x[0]; c == '=' || c == '<' { + val, err := strconv.ParseUint(x[1:], 10, 16) + if err != nil { + return fmt.Errorf("plural: invalid number in selector %q: %v", selector, err) + } + e.EncodeUint(uint64(c)) + e.EncodeUint(val) + return nil + } + var ok bool + form, ok = countMap[x] + if !ok { + return fmt.Errorf("plural: invalid plural form %q", selector) + } + case Form: + form = x + default: + return fmt.Errorf("plural: selector of type %T; want string or Form", selector) + } + + ok := false + for _, f := range valid { + if f == form { + ok = true + break + } + } + if !ok { + return fmt.Errorf("plural: form %q not supported for language %q", selector, e.Language()) + } + e.EncodeUint(uint64(form)) + return nil +} + +func execute(d *catmsg.Decoder) bool { + lang := d.Language() + argN := int(d.DecodeUint()) + kind := int(d.DecodeUint()) + scale := -1 // default + if kind > kindDefault { + scale = int(d.DecodeUint()) + } + form := Other + n := -1 + if arg := d.Arg(argN); arg == nil { + // Default to Other. + } else if x, ok := arg.(number.VisibleDigits); ok { + d := x.Digits(nil, lang, scale) + form, n = cardinal.matchDisplayDigits(lang, &d) + } else if x, ok := arg.(Interface); ok { + // This covers lists and formatters from the number package. + form, n = x.PluralForm(lang, scale) + } else { + var f number.Formatter + switch kind { + case kindScale: + f.InitDecimal(lang) + f.SetScale(scale) + case kindScientific: + f.InitScientific(lang) + f.SetScale(scale) + case kindPrecision: + f.InitDecimal(lang) + f.SetPrecision(scale) + case kindDefault: + // sensible default + f.InitDecimal(lang) + if k := reflect.TypeOf(arg).Kind(); reflect.Int <= k && k <= reflect.Uintptr { + f.SetScale(0) + } else { + f.SetScale(2) + } + } + var dec number.Decimal // TODO: buffer in Printer + dec.Convert(f.RoundingContext, arg) + v := number.FormatDigits(&dec, f.RoundingContext) + if !v.NaN && !v.Inf { + form, n = cardinal.matchDisplayDigits(d.Language(), &v) + } + } + for !d.Done() { + f := d.DecodeUint() + if (f == '=' && n == int(d.DecodeUint())) || + (f == '<' && 0 <= n && n < int(d.DecodeUint())) || + form == Form(f) || + Other == Form(f) { + return d.ExecuteMessage() + } + d.SkipMessage() + } + return false +} diff --git a/vendor/golang.org/x/text/feature/plural/plural.go b/vendor/golang.org/x/text/feature/plural/plural.go new file mode 100644 index 0000000..e9f2d42 --- /dev/null +++ b/vendor/golang.org/x/text/feature/plural/plural.go @@ -0,0 +1,262 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go + +// Package plural provides utilities for handling linguistic plurals in text. +// +// The definitions in this package are based on the plural rule handling defined +// in CLDR. See +// https://unicode.org/reports/tr35/tr35-numbers.html#Language_Plural_Rules for +// details. +package plural + +import ( + "golang.org/x/text/internal/language/compact" + "golang.org/x/text/internal/number" + "golang.org/x/text/language" +) + +// Rules defines the plural rules for all languages for a certain plural type. +// +// This package is UNDER CONSTRUCTION and its API may change. +type Rules struct { + rules []pluralCheck + index []byte + langToIndex []byte + inclusionMasks []uint64 +} + +var ( + // Cardinal defines the plural rules for numbers indicating quantities. + Cardinal *Rules = cardinal + + // Ordinal defines the plural rules for numbers indicating position + // (first, second, etc.). + Ordinal *Rules = ordinal + + ordinal = &Rules{ + ordinalRules, + ordinalIndex, + ordinalLangToIndex, + ordinalInclusionMasks[:], + } + + cardinal = &Rules{ + cardinalRules, + cardinalIndex, + cardinalLangToIndex, + cardinalInclusionMasks[:], + } +) + +// getIntApprox converts the digits in slice digits[start:end] to an integer +// according to the following rules: +// - Let i be asInt(digits[start:end]), where out-of-range digits are assumed +// to be zero. +// - Result n is big if i / 10^nMod > 1. +// - Otherwise the result is i % 10^nMod. +// +// For example, if digits is {1, 2, 3} and start:end is 0:5, then the result +// for various values of nMod is: +// - when nMod == 2, n == big +// - when nMod == 3, n == big +// - when nMod == 4, n == big +// - when nMod == 5, n == 12300 +// - when nMod == 6, n == 12300 +// - when nMod == 7, n == 12300 +func getIntApprox(digits []byte, start, end, nMod, big int) (n int) { + // Leading 0 digits just result in 0. + p := start + if p < 0 { + p = 0 + } + // Range only over the part for which we have digits. + mid := end + if mid >= len(digits) { + mid = len(digits) + } + // Check digits more significant that nMod. + if q := end - nMod; q > 0 { + if q > mid { + q = mid + } + for ; p < q; p++ { + if digits[p] != 0 { + return big + } + } + } + for ; p < mid; p++ { + n = 10*n + int(digits[p]) + } + // Multiply for trailing zeros. + for ; p < end; p++ { + n *= 10 + } + return n +} + +// MatchDigits computes the plural form for the given language and the given +// decimal floating point digits. The digits are stored in big-endian order and +// are of value byte(0) - byte(9). The floating point position is indicated by +// exp and the number of visible decimals is scale. All leading and trailing +// zeros may be omitted from digits. +// +// The following table contains examples of possible arguments to represent +// the given numbers. +// +// decimal digits exp scale +// 123 []byte{1, 2, 3} 3 0 +// 123.4 []byte{1, 2, 3, 4} 3 1 +// 123.40 []byte{1, 2, 3, 4} 3 2 +// 100000 []byte{1} 6 0 +// 100000.00 []byte{1} 6 3 +func (p *Rules) MatchDigits(t language.Tag, digits []byte, exp, scale int) Form { + index := tagToID(t) + + // Differentiate up to including mod 1000000 for the integer part. + n := getIntApprox(digits, 0, exp, 6, 1000000) + + // Differentiate up to including mod 100 for the fractional part. + f := getIntApprox(digits, exp, exp+scale, 2, 100) + + return matchPlural(p, index, n, f, scale) +} + +func (p *Rules) matchDisplayDigits(t language.Tag, d *number.Digits) (Form, int) { + n := getIntApprox(d.Digits, 0, int(d.Exp), 6, 1000000) + return p.MatchDigits(t, d.Digits, int(d.Exp), d.NumFracDigits()), n +} + +func validForms(p *Rules, t language.Tag) (forms []Form) { + offset := p.langToIndex[tagToID(t)] + rules := p.rules[p.index[offset]:p.index[offset+1]] + + forms = append(forms, Other) + last := Other + for _, r := range rules { + if cat := Form(r.cat & formMask); cat != andNext && last != cat { + forms = append(forms, cat) + last = cat + } + } + return forms +} + +func (p *Rules) matchComponents(t language.Tag, n, f, scale int) Form { + return matchPlural(p, tagToID(t), n, f, scale) +} + +// MatchPlural returns the plural form for the given language and plural +// operands (as defined in +// https://unicode.org/reports/tr35/tr35-numbers.html#Language_Plural_Rules): +// +// where +// n absolute value of the source number (integer and decimals) +// input +// i integer digits of n. +// v number of visible fraction digits in n, with trailing zeros. +// w number of visible fraction digits in n, without trailing zeros. +// f visible fractional digits in n, with trailing zeros (f = t * 10^(v-w)) +// t visible fractional digits in n, without trailing zeros. +// +// If any of the operand values is too large to fit in an int, it is okay to +// pass the value modulo 10,000,000. +func (p *Rules) MatchPlural(lang language.Tag, i, v, w, f, t int) Form { + return matchPlural(p, tagToID(lang), i, f, v) +} + +func matchPlural(p *Rules, index compact.ID, n, f, v int) Form { + nMask := p.inclusionMasks[n%maxMod] + // Compute the fMask inline in the rules below, as it is relatively rare. + // fMask := p.inclusionMasks[f%maxMod] + vMask := p.inclusionMasks[v%maxMod] + + // Do the matching + offset := p.langToIndex[index] + rules := p.rules[p.index[offset]:p.index[offset+1]] + for i := 0; i < len(rules); i++ { + rule := rules[i] + setBit := uint64(1 << rule.setID) + var skip bool + switch op := opID(rule.cat >> opShift); op { + case opI: // i = x + skip = n >= numN || nMask&setBit == 0 + + case opI | opNotEqual: // i != x + skip = n < numN && nMask&setBit != 0 + + case opI | opMod: // i % m = x + skip = nMask&setBit == 0 + + case opI | opMod | opNotEqual: // i % m != x + skip = nMask&setBit != 0 + + case opN: // n = x + skip = f != 0 || n >= numN || nMask&setBit == 0 + + case opN | opNotEqual: // n != x + skip = f == 0 && n < numN && nMask&setBit != 0 + + case opN | opMod: // n % m = x + skip = f != 0 || nMask&setBit == 0 + + case opN | opMod | opNotEqual: // n % m != x + skip = f == 0 && nMask&setBit != 0 + + case opF: // f = x + skip = f >= numN || p.inclusionMasks[f%maxMod]&setBit == 0 + + case opF | opNotEqual: // f != x + skip = f < numN && p.inclusionMasks[f%maxMod]&setBit != 0 + + case opF | opMod: // f % m = x + skip = p.inclusionMasks[f%maxMod]&setBit == 0 + + case opF | opMod | opNotEqual: // f % m != x + skip = p.inclusionMasks[f%maxMod]&setBit != 0 + + case opV: // v = x + skip = v < numN && vMask&setBit == 0 + + case opV | opNotEqual: // v != x + skip = v < numN && vMask&setBit != 0 + + case opW: // w == 0 + skip = f != 0 + + case opW | opNotEqual: // w != 0 + skip = f == 0 + + // Hard-wired rules that cannot be handled by our algorithm. + + case opBretonM: + skip = f != 0 || n == 0 || n%1000000 != 0 + + case opAzerbaijan00s: + // 100,200,300,400,500,600,700,800,900 + skip = n == 0 || n >= 1000 || n%100 != 0 + + case opItalian800: + skip = (f != 0 || n >= numN || nMask&setBit == 0) && n != 800 + } + if skip { + // advance over AND entries. + for ; i < len(rules) && rules[i].cat&formMask == andNext; i++ { + } + continue + } + // return if we have a final entry. + if cat := rule.cat & formMask; cat != andNext { + return Form(cat) + } + } + return Other +} + +func tagToID(t language.Tag) compact.ID { + id, _ := compact.RegionalID(compact.Tag(t)) + return id +} diff --git a/vendor/golang.org/x/text/feature/plural/tables.go b/vendor/golang.org/x/text/feature/plural/tables.go new file mode 100644 index 0000000..b06b9cb --- /dev/null +++ b/vendor/golang.org/x/text/feature/plural/tables.go @@ -0,0 +1,552 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package plural + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +var ordinalRules = []pluralCheck{ // 64 elements + 0: {cat: 0x2f, setID: 0x4}, + 1: {cat: 0x3a, setID: 0x5}, + 2: {cat: 0x22, setID: 0x1}, + 3: {cat: 0x22, setID: 0x6}, + 4: {cat: 0x22, setID: 0x7}, + 5: {cat: 0x2f, setID: 0x8}, + 6: {cat: 0x3c, setID: 0x9}, + 7: {cat: 0x2f, setID: 0xa}, + 8: {cat: 0x3c, setID: 0xb}, + 9: {cat: 0x2c, setID: 0xc}, + 10: {cat: 0x24, setID: 0xd}, + 11: {cat: 0x2d, setID: 0xe}, + 12: {cat: 0x2d, setID: 0xf}, + 13: {cat: 0x2f, setID: 0x10}, + 14: {cat: 0x35, setID: 0x3}, + 15: {cat: 0xc5, setID: 0x11}, + 16: {cat: 0x2, setID: 0x1}, + 17: {cat: 0x5, setID: 0x3}, + 18: {cat: 0xd, setID: 0x12}, + 19: {cat: 0x22, setID: 0x1}, + 20: {cat: 0x2f, setID: 0x13}, + 21: {cat: 0x3d, setID: 0x14}, + 22: {cat: 0x2f, setID: 0x15}, + 23: {cat: 0x3a, setID: 0x16}, + 24: {cat: 0x2f, setID: 0x17}, + 25: {cat: 0x3b, setID: 0x18}, + 26: {cat: 0x2f, setID: 0xa}, + 27: {cat: 0x3c, setID: 0xb}, + 28: {cat: 0x22, setID: 0x1}, + 29: {cat: 0x23, setID: 0x19}, + 30: {cat: 0x24, setID: 0x1a}, + 31: {cat: 0x22, setID: 0x1b}, + 32: {cat: 0x23, setID: 0x2}, + 33: {cat: 0x24, setID: 0x1a}, + 34: {cat: 0xf, setID: 0x15}, + 35: {cat: 0x1a, setID: 0x16}, + 36: {cat: 0xf, setID: 0x17}, + 37: {cat: 0x1b, setID: 0x18}, + 38: {cat: 0xf, setID: 0x1c}, + 39: {cat: 0x1d, setID: 0x1d}, + 40: {cat: 0xa, setID: 0x1e}, + 41: {cat: 0xa, setID: 0x1f}, + 42: {cat: 0xc, setID: 0x20}, + 43: {cat: 0xe4, setID: 0x0}, + 44: {cat: 0x5, setID: 0x3}, + 45: {cat: 0xd, setID: 0xe}, + 46: {cat: 0xd, setID: 0x21}, + 47: {cat: 0x22, setID: 0x1}, + 48: {cat: 0x23, setID: 0x19}, + 49: {cat: 0x24, setID: 0x1a}, + 50: {cat: 0x25, setID: 0x22}, + 51: {cat: 0x22, setID: 0x23}, + 52: {cat: 0x23, setID: 0x19}, + 53: {cat: 0x24, setID: 0x1a}, + 54: {cat: 0x25, setID: 0x22}, + 55: {cat: 0x22, setID: 0x24}, + 56: {cat: 0x23, setID: 0x19}, + 57: {cat: 0x24, setID: 0x1a}, + 58: {cat: 0x25, setID: 0x22}, + 59: {cat: 0x21, setID: 0x25}, + 60: {cat: 0x22, setID: 0x1}, + 61: {cat: 0x23, setID: 0x2}, + 62: {cat: 0x24, setID: 0x26}, + 63: {cat: 0x25, setID: 0x27}, +} // Size: 152 bytes + +var ordinalIndex = []uint8{ // 22 elements + 0x00, 0x00, 0x02, 0x03, 0x04, 0x05, 0x07, 0x09, + 0x0b, 0x0f, 0x10, 0x13, 0x16, 0x1c, 0x1f, 0x22, + 0x28, 0x2f, 0x33, 0x37, 0x3b, 0x40, +} // Size: 46 bytes + +var ordinalLangToIndex = []uint8{ // 775 elements + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x12, 0x12, 0x00, 0x00, 0x00, 0x00, 0x10, 0x10, + 0x10, 0x10, 0x10, 0x00, 0x00, 0x05, 0x05, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x12, 0x12, 0x12, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, + 0x0e, 0x0e, 0x0e, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x14, 0x14, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + // Entry C0 - FF + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, + 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x0c, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x02, + 0x00, 0x00, 0x00, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 140 - 17F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x02, 0x02, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x11, 0x11, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x11, + 0x11, 0x00, 0x00, 0x00, 0x00, 0x00, 0x03, 0x03, + 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x09, 0x09, 0x09, 0x09, + 0x09, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x0a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x08, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x0f, 0x0f, 0x00, 0x00, + 0x00, 0x00, 0x02, 0x0d, 0x0d, 0x02, 0x02, 0x02, + 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x13, 0x13, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x0b, 0x0b, 0x0b, 0x0b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x01, 0x01, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x07, 0x07, 0x02, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x06, 0x06, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x0c, +} // Size: 799 bytes + +var ordinalInclusionMasks = []uint64{ // 100 elements + // Entry 0 - 1F + 0x0000002000010009, 0x00000018482000d3, 0x0000000042840195, 0x000000410a040581, + 0x00000041040c0081, 0x0000009840040041, 0x0000008400045001, 0x0000003850040001, + 0x0000003850060001, 0x0000003800049001, 0x0000000800052001, 0x0000000040660031, + 0x0000000041840331, 0x0000000100040f01, 0x00000001001c0001, 0x0000000040040001, + 0x0000000000045001, 0x0000000070040001, 0x0000000070040001, 0x0000000000049001, + 0x0000000080050001, 0x0000000040200011, 0x0000000040800111, 0x0000000100000501, + 0x0000000100080001, 0x0000000040000001, 0x0000000000005001, 0x0000000050000001, + 0x0000000050000001, 0x0000000000009001, 0x0000000000010001, 0x0000000040200011, + // Entry 20 - 3F + 0x0000000040800111, 0x0000000100000501, 0x0000000100080001, 0x0000000040000001, + 0x0000000000005001, 0x0000000050000001, 0x0000000050000001, 0x0000000000009001, + 0x0000000200050001, 0x0000000040200011, 0x0000000040800111, 0x0000000100000501, + 0x0000000100080001, 0x0000000040000001, 0x0000000000005001, 0x0000000050000001, + 0x0000000050000001, 0x0000000000009001, 0x0000000080010001, 0x0000000040200011, + 0x0000000040800111, 0x0000000100000501, 0x0000000100080001, 0x0000000040000001, + 0x0000000000005001, 0x0000000050000001, 0x0000000050000001, 0x0000000000009001, + 0x0000000200050001, 0x0000000040200011, 0x0000000040800111, 0x0000000100000501, + // Entry 40 - 5F + 0x0000000100080001, 0x0000000040000001, 0x0000000000005001, 0x0000000050000001, + 0x0000000050000001, 0x0000000000009001, 0x0000000080010001, 0x0000000040200011, + 0x0000000040800111, 0x0000000100000501, 0x0000000100080001, 0x0000000040000001, + 0x0000000000005001, 0x0000000050000001, 0x0000000050000001, 0x0000000000009001, + 0x0000000080070001, 0x0000000040200011, 0x0000000040800111, 0x0000000100000501, + 0x0000000100080001, 0x0000000040000001, 0x0000000000005001, 0x0000000050000001, + 0x0000000050000001, 0x0000000000009001, 0x0000000200010001, 0x0000000040200011, + 0x0000000040800111, 0x0000000100000501, 0x0000000100080001, 0x0000000040000001, + // Entry 60 - 7F + 0x0000000000005001, 0x0000000050000001, 0x0000000050000001, 0x0000000000009001, +} // Size: 824 bytes + +// Slots used for ordinal: 40 of 0xFF rules; 16 of 0xFF indexes; 40 of 64 sets + +var cardinalRules = []pluralCheck{ // 166 elements + 0: {cat: 0x2, setID: 0x3}, + 1: {cat: 0x22, setID: 0x1}, + 2: {cat: 0x2, setID: 0x4}, + 3: {cat: 0x2, setID: 0x4}, + 4: {cat: 0x7, setID: 0x1}, + 5: {cat: 0x62, setID: 0x3}, + 6: {cat: 0x22, setID: 0x4}, + 7: {cat: 0x7, setID: 0x3}, + 8: {cat: 0x42, setID: 0x1}, + 9: {cat: 0x22, setID: 0x4}, + 10: {cat: 0x22, setID: 0x4}, + 11: {cat: 0x22, setID: 0x5}, + 12: {cat: 0x22, setID: 0x1}, + 13: {cat: 0x22, setID: 0x1}, + 14: {cat: 0x7, setID: 0x4}, + 15: {cat: 0x92, setID: 0x3}, + 16: {cat: 0xf, setID: 0x6}, + 17: {cat: 0x1f, setID: 0x7}, + 18: {cat: 0x82, setID: 0x3}, + 19: {cat: 0x92, setID: 0x3}, + 20: {cat: 0xf, setID: 0x6}, + 21: {cat: 0x62, setID: 0x3}, + 22: {cat: 0x4a, setID: 0x6}, + 23: {cat: 0x7, setID: 0x8}, + 24: {cat: 0x62, setID: 0x3}, + 25: {cat: 0x1f, setID: 0x9}, + 26: {cat: 0x62, setID: 0x3}, + 27: {cat: 0x5f, setID: 0x9}, + 28: {cat: 0x72, setID: 0x3}, + 29: {cat: 0x29, setID: 0xa}, + 30: {cat: 0x29, setID: 0xb}, + 31: {cat: 0x4f, setID: 0xb}, + 32: {cat: 0x61, setID: 0x2}, + 33: {cat: 0x2f, setID: 0x6}, + 34: {cat: 0x3a, setID: 0x7}, + 35: {cat: 0x4f, setID: 0x6}, + 36: {cat: 0x5f, setID: 0x7}, + 37: {cat: 0x62, setID: 0x2}, + 38: {cat: 0x4f, setID: 0x6}, + 39: {cat: 0x72, setID: 0x2}, + 40: {cat: 0x21, setID: 0x3}, + 41: {cat: 0x7, setID: 0x4}, + 42: {cat: 0x32, setID: 0x3}, + 43: {cat: 0x21, setID: 0x3}, + 44: {cat: 0x22, setID: 0x1}, + 45: {cat: 0x22, setID: 0x1}, + 46: {cat: 0x23, setID: 0x2}, + 47: {cat: 0x2, setID: 0x3}, + 48: {cat: 0x22, setID: 0x1}, + 49: {cat: 0x24, setID: 0xc}, + 50: {cat: 0x7, setID: 0x1}, + 51: {cat: 0x62, setID: 0x3}, + 52: {cat: 0x74, setID: 0x3}, + 53: {cat: 0x24, setID: 0x3}, + 54: {cat: 0x2f, setID: 0xd}, + 55: {cat: 0x34, setID: 0x1}, + 56: {cat: 0xf, setID: 0x6}, + 57: {cat: 0x1f, setID: 0x7}, + 58: {cat: 0x62, setID: 0x3}, + 59: {cat: 0x4f, setID: 0x6}, + 60: {cat: 0x5a, setID: 0x7}, + 61: {cat: 0xf, setID: 0xe}, + 62: {cat: 0x1f, setID: 0xf}, + 63: {cat: 0x64, setID: 0x3}, + 64: {cat: 0x4f, setID: 0xe}, + 65: {cat: 0x5c, setID: 0xf}, + 66: {cat: 0x22, setID: 0x10}, + 67: {cat: 0x23, setID: 0x11}, + 68: {cat: 0x24, setID: 0x12}, + 69: {cat: 0xf, setID: 0x1}, + 70: {cat: 0x62, setID: 0x3}, + 71: {cat: 0xf, setID: 0x2}, + 72: {cat: 0x63, setID: 0x3}, + 73: {cat: 0xf, setID: 0x13}, + 74: {cat: 0x64, setID: 0x3}, + 75: {cat: 0x74, setID: 0x3}, + 76: {cat: 0xf, setID: 0x1}, + 77: {cat: 0x62, setID: 0x3}, + 78: {cat: 0x4a, setID: 0x1}, + 79: {cat: 0xf, setID: 0x2}, + 80: {cat: 0x63, setID: 0x3}, + 81: {cat: 0x4b, setID: 0x2}, + 82: {cat: 0xf, setID: 0x13}, + 83: {cat: 0x64, setID: 0x3}, + 84: {cat: 0x4c, setID: 0x13}, + 85: {cat: 0x7, setID: 0x1}, + 86: {cat: 0x62, setID: 0x3}, + 87: {cat: 0x7, setID: 0x2}, + 88: {cat: 0x63, setID: 0x3}, + 89: {cat: 0x2f, setID: 0xa}, + 90: {cat: 0x37, setID: 0x14}, + 91: {cat: 0x65, setID: 0x3}, + 92: {cat: 0x7, setID: 0x1}, + 93: {cat: 0x62, setID: 0x3}, + 94: {cat: 0x7, setID: 0x15}, + 95: {cat: 0x64, setID: 0x3}, + 96: {cat: 0x75, setID: 0x3}, + 97: {cat: 0x7, setID: 0x1}, + 98: {cat: 0x62, setID: 0x3}, + 99: {cat: 0xf, setID: 0xe}, + 100: {cat: 0x1f, setID: 0xf}, + 101: {cat: 0x64, setID: 0x3}, + 102: {cat: 0xf, setID: 0x16}, + 103: {cat: 0x17, setID: 0x1}, + 104: {cat: 0x65, setID: 0x3}, + 105: {cat: 0xf, setID: 0x17}, + 106: {cat: 0x65, setID: 0x3}, + 107: {cat: 0xf, setID: 0xf}, + 108: {cat: 0x65, setID: 0x3}, + 109: {cat: 0x2f, setID: 0x6}, + 110: {cat: 0x3a, setID: 0x7}, + 111: {cat: 0x2f, setID: 0xe}, + 112: {cat: 0x3c, setID: 0xf}, + 113: {cat: 0x2d, setID: 0xa}, + 114: {cat: 0x2d, setID: 0x17}, + 115: {cat: 0x2d, setID: 0x18}, + 116: {cat: 0x2f, setID: 0x6}, + 117: {cat: 0x3a, setID: 0xb}, + 118: {cat: 0x2f, setID: 0x19}, + 119: {cat: 0x3c, setID: 0xb}, + 120: {cat: 0x55, setID: 0x3}, + 121: {cat: 0x22, setID: 0x1}, + 122: {cat: 0x24, setID: 0x3}, + 123: {cat: 0x2c, setID: 0xc}, + 124: {cat: 0x2d, setID: 0xb}, + 125: {cat: 0xf, setID: 0x6}, + 126: {cat: 0x1f, setID: 0x7}, + 127: {cat: 0x62, setID: 0x3}, + 128: {cat: 0xf, setID: 0xe}, + 129: {cat: 0x1f, setID: 0xf}, + 130: {cat: 0x64, setID: 0x3}, + 131: {cat: 0xf, setID: 0xa}, + 132: {cat: 0x65, setID: 0x3}, + 133: {cat: 0xf, setID: 0x17}, + 134: {cat: 0x65, setID: 0x3}, + 135: {cat: 0xf, setID: 0x18}, + 136: {cat: 0x65, setID: 0x3}, + 137: {cat: 0x2f, setID: 0x6}, + 138: {cat: 0x3a, setID: 0x1a}, + 139: {cat: 0x2f, setID: 0x1b}, + 140: {cat: 0x3b, setID: 0x1c}, + 141: {cat: 0x2f, setID: 0x1d}, + 142: {cat: 0x3c, setID: 0x1e}, + 143: {cat: 0x37, setID: 0x3}, + 144: {cat: 0xa5, setID: 0x0}, + 145: {cat: 0x22, setID: 0x1}, + 146: {cat: 0x23, setID: 0x2}, + 147: {cat: 0x24, setID: 0x1f}, + 148: {cat: 0x25, setID: 0x20}, + 149: {cat: 0xf, setID: 0x6}, + 150: {cat: 0x62, setID: 0x3}, + 151: {cat: 0xf, setID: 0x1b}, + 152: {cat: 0x63, setID: 0x3}, + 153: {cat: 0xf, setID: 0x21}, + 154: {cat: 0x64, setID: 0x3}, + 155: {cat: 0x75, setID: 0x3}, + 156: {cat: 0x21, setID: 0x3}, + 157: {cat: 0x22, setID: 0x1}, + 158: {cat: 0x23, setID: 0x2}, + 159: {cat: 0x2c, setID: 0x22}, + 160: {cat: 0x2d, setID: 0x5}, + 161: {cat: 0x21, setID: 0x3}, + 162: {cat: 0x22, setID: 0x1}, + 163: {cat: 0x23, setID: 0x2}, + 164: {cat: 0x24, setID: 0x23}, + 165: {cat: 0x25, setID: 0x24}, +} // Size: 356 bytes + +var cardinalIndex = []uint8{ // 36 elements + 0x00, 0x00, 0x02, 0x03, 0x04, 0x06, 0x09, 0x0a, + 0x0c, 0x0d, 0x10, 0x14, 0x17, 0x1d, 0x28, 0x2b, + 0x2d, 0x2f, 0x32, 0x38, 0x42, 0x45, 0x4c, 0x55, + 0x5c, 0x61, 0x6d, 0x74, 0x79, 0x7d, 0x89, 0x91, + 0x95, 0x9c, 0xa1, 0xa6, +} // Size: 60 bytes + +var cardinalLangToIndex = []uint8{ // 775 elements + // Entry 0 - 3F + 0x00, 0x08, 0x08, 0x08, 0x00, 0x00, 0x06, 0x06, + 0x01, 0x01, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x01, 0x01, 0x08, 0x08, 0x04, 0x04, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x00, 0x00, 0x1a, 0x1a, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x06, 0x00, 0x00, + // Entry 40 - 7F + 0x01, 0x01, 0x01, 0x00, 0x00, 0x00, 0x1e, 0x1e, + 0x08, 0x08, 0x13, 0x13, 0x13, 0x13, 0x13, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x18, 0x18, 0x00, 0x00, 0x22, 0x22, 0x09, 0x09, + 0x09, 0x00, 0x00, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x00, 0x00, 0x16, 0x16, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 80 - BF + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry C0 - FF + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + // Entry 100 - 13F + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x04, 0x04, + 0x08, 0x08, 0x00, 0x00, 0x01, 0x01, 0x01, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x04, 0x04, 0x0c, 0x0c, + 0x08, 0x08, 0x08, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 140 - 17F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x08, 0x08, 0x04, 0x04, 0x1f, 0x1f, + 0x14, 0x14, 0x04, 0x04, 0x08, 0x08, 0x08, 0x08, + 0x01, 0x01, 0x06, 0x00, 0x00, 0x20, 0x20, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x17, 0x17, 0x01, + 0x01, 0x13, 0x13, 0x13, 0x16, 0x16, 0x08, 0x08, + 0x02, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x04, 0x0a, 0x0a, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x10, 0x17, 0x00, 0x00, 0x00, 0x08, 0x08, + 0x04, 0x08, 0x08, 0x00, 0x00, 0x08, 0x08, 0x02, + 0x02, 0x08, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x00, 0x00, 0x00, 0x00, 0x01, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, 0x08, + 0x08, 0x08, 0x00, 0x00, 0x0f, 0x0f, 0x08, 0x10, + // Entry 1C0 - 1FF + 0x10, 0x08, 0x08, 0x0e, 0x0e, 0x08, 0x08, 0x08, + 0x08, 0x00, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x1b, 0x1b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0d, 0x0d, 0x08, + 0x08, 0x08, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, + 0x00, 0x00, 0x08, 0x08, 0x0b, 0x0b, 0x08, 0x08, + 0x08, 0x08, 0x12, 0x01, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x1c, 0x1c, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x00, 0x08, 0x10, 0x10, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x00, 0x00, 0x00, 0x08, 0x08, 0x08, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x08, 0x08, 0x08, 0x08, 0x08, 0x00, 0x08, + 0x06, 0x00, 0x00, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x08, 0x19, 0x19, 0x0d, 0x0d, + 0x08, 0x08, 0x03, 0x04, 0x03, 0x04, 0x04, 0x04, + // Entry 240 - 27F + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x12, + 0x12, 0x12, 0x08, 0x08, 0x1d, 0x1d, 0x1d, 0x1d, + 0x1d, 0x1d, 0x1d, 0x00, 0x00, 0x08, 0x08, 0x00, + 0x00, 0x08, 0x08, 0x00, 0x00, 0x08, 0x08, 0x08, + 0x10, 0x10, 0x10, 0x10, 0x08, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x13, 0x11, 0x11, 0x11, 0x11, 0x11, + 0x05, 0x05, 0x18, 0x18, 0x15, 0x15, 0x10, 0x10, + // Entry 280 - 2BF + 0x10, 0x10, 0x10, 0x10, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x13, + 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, + 0x13, 0x13, 0x08, 0x08, 0x08, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x00, 0x00, 0x00, 0x00, 0x06, 0x06, 0x06, + 0x08, 0x08, 0x08, 0x0c, 0x08, 0x00, 0x00, 0x08, + // Entry 2C0 - 2FF + 0x08, 0x08, 0x08, 0x00, 0x00, 0x00, 0x00, 0x07, + 0x07, 0x08, 0x08, 0x1d, 0x1d, 0x04, 0x04, 0x04, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x08, + 0x08, 0x08, 0x08, 0x06, 0x08, 0x08, 0x00, 0x00, + 0x08, 0x08, 0x08, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x01, 0x01, 0x04, 0x04, +} // Size: 799 bytes + +var cardinalInclusionMasks = []uint64{ // 100 elements + // Entry 0 - 1F + 0x0000000200500419, 0x0000000000512153, 0x000000000a327105, 0x0000000ca23c7101, + 0x00000004a23c7201, 0x0000000482943001, 0x0000001482943201, 0x0000000502943001, + 0x0000000502943001, 0x0000000522943201, 0x0000000540543401, 0x00000000454128e1, + 0x000000005b02e821, 0x000000006304e821, 0x000000006304ea21, 0x0000000042842821, + 0x0000000042842a21, 0x0000000042842821, 0x0000000042842821, 0x0000000062842a21, + 0x0000000200400421, 0x0000000000400061, 0x000000000a004021, 0x0000000022004021, + 0x0000000022004221, 0x0000000002800021, 0x0000000002800221, 0x0000000002800021, + 0x0000000002800021, 0x0000000022800221, 0x0000000000400421, 0x0000000000400061, + // Entry 20 - 3F + 0x000000000a004021, 0x0000000022004021, 0x0000000022004221, 0x0000000002800021, + 0x0000000002800221, 0x0000000002800021, 0x0000000002800021, 0x0000000022800221, + 0x0000000200400421, 0x0000000000400061, 0x000000000a004021, 0x0000000022004021, + 0x0000000022004221, 0x0000000002800021, 0x0000000002800221, 0x0000000002800021, + 0x0000000002800021, 0x0000000022800221, 0x0000000000400421, 0x0000000000400061, + 0x000000000a004021, 0x0000000022004021, 0x0000000022004221, 0x0000000002800021, + 0x0000000002800221, 0x0000000002800021, 0x0000000002800021, 0x0000000022800221, + 0x0000000200400421, 0x0000000000400061, 0x000000000a004021, 0x0000000022004021, + // Entry 40 - 5F + 0x0000000022004221, 0x0000000002800021, 0x0000000002800221, 0x0000000002800021, + 0x0000000002800021, 0x0000000022800221, 0x0000000040400421, 0x0000000044400061, + 0x000000005a004021, 0x0000000062004021, 0x0000000062004221, 0x0000000042800021, + 0x0000000042800221, 0x0000000042800021, 0x0000000042800021, 0x0000000062800221, + 0x0000000200400421, 0x0000000000400061, 0x000000000a004021, 0x0000000022004021, + 0x0000000022004221, 0x0000000002800021, 0x0000000002800221, 0x0000000002800021, + 0x0000000002800021, 0x0000000022800221, 0x0000000040400421, 0x0000000044400061, + 0x000000005a004021, 0x0000000062004021, 0x0000000062004221, 0x0000000042800021, + // Entry 60 - 7F + 0x0000000042800221, 0x0000000042800021, 0x0000000042800021, 0x0000000062800221, +} // Size: 824 bytes + +// Slots used for cardinal: A6 of 0xFF rules; 24 of 0xFF indexes; 37 of 64 sets + +// Total table size 3860 bytes (3KiB); checksum: AAFBF21 diff --git a/vendor/golang.org/x/text/internal/catmsg/catmsg.go b/vendor/golang.org/x/text/internal/catmsg/catmsg.go new file mode 100644 index 0000000..1b257a7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/catmsg/catmsg.go @@ -0,0 +1,417 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package catmsg contains support types for package x/text/message/catalog. +// +// This package contains the low-level implementations of Message used by the +// catalog package and provides primitives for other packages to implement their +// own. For instance, the plural package provides functionality for selecting +// translation strings based on the plural category of substitution arguments. +// +// # Encoding and Decoding +// +// Catalogs store Messages encoded as a single string. Compiling a message into +// a string both results in compacter representation and speeds up evaluation. +// +// A Message must implement a Compile method to convert its arbitrary +// representation to a string. The Compile method takes an Encoder which +// facilitates serializing the message. Encoders also provide more context of +// the messages's creation (such as for which language the message is intended), +// which may not be known at the time of the creation of the message. +// +// Each message type must also have an accompanying decoder registered to decode +// the message. This decoder takes a Decoder argument which provides the +// counterparts for the decoding. +// +// # Renderers +// +// A Decoder must be initialized with a Renderer implementation. These +// implementations must be provided by packages that use Catalogs, typically +// formatting packages such as x/text/message. A typical user will not need to +// worry about this type; it is only relevant to packages that do string +// formatting and want to use the catalog package to handle localized strings. +// +// A package that uses catalogs for selecting strings receives selection results +// as sequence of substrings passed to the Renderer. The following snippet shows +// how to express the above example using the message package. +// +// message.Set(language.English, "You are %d minute(s) late.", +// catalog.Var("minutes", plural.Select(1, "one", "minute")), +// catalog.String("You are %[1]d ${minutes} late.")) +// +// p := message.NewPrinter(language.English) +// p.Printf("You are %d minute(s) late.", 5) // always 5 minutes late. +// +// To evaluate the Printf, package message wraps the arguments in a Renderer +// that is passed to the catalog for message decoding. The call sequence that +// results from evaluating the above message, assuming the person is rather +// tardy, is: +// +// Render("You are %[1]d ") +// Arg(1) +// Render("minutes") +// Render(" late.") +// +// The calls to Arg is caused by the plural.Select execution, which evaluates +// the argument to determine whether the singular or plural message form should +// be selected. The calls to Render reports the partial results to the message +// package for further evaluation. +package catmsg + +import ( + "errors" + "fmt" + "strconv" + "strings" + "sync" + + "golang.org/x/text/language" +) + +// A Handle refers to a registered message type. +type Handle int + +// A Handler decodes and evaluates data compiled by a Message and sends the +// result to the Decoder. The output may depend on the value of the substitution +// arguments, accessible by the Decoder's Arg method. The Handler returns false +// if there is no translation for the given substitution arguments. +type Handler func(d *Decoder) bool + +// Register records the existence of a message type and returns a Handle that +// can be used in the Encoder's EncodeMessageType method to create such +// messages. The prefix of the name should be the package path followed by +// an optional disambiguating string. +// Register will panic if a handle for the same name was already registered. +func Register(name string, handler Handler) Handle { + mutex.Lock() + defer mutex.Unlock() + + if _, ok := names[name]; ok { + panic(fmt.Errorf("catmsg: handler for %q already exists", name)) + } + h := Handle(len(handlers)) + names[name] = h + handlers = append(handlers, handler) + return h +} + +// These handlers require fixed positions in the handlers slice. +const ( + msgVars Handle = iota + msgFirst + msgRaw + msgString + msgAffix + // Leave some arbitrary room for future expansion: 20 should suffice. + numInternal = 20 +) + +const prefix = "golang.org/x/text/internal/catmsg." + +var ( + // TODO: find a more stable way to link handles to message types. + mutex sync.Mutex + names = map[string]Handle{ + prefix + "Vars": msgVars, + prefix + "First": msgFirst, + prefix + "Raw": msgRaw, + prefix + "String": msgString, + prefix + "Affix": msgAffix, + } + handlers = make([]Handler, numInternal) +) + +func init() { + // This handler is a message type wrapper that initializes a decoder + // with a variable block. This message type, if present, is always at the + // start of an encoded message. + handlers[msgVars] = func(d *Decoder) bool { + blockSize := int(d.DecodeUint()) + d.vars = d.data[:blockSize] + d.data = d.data[blockSize:] + return d.executeMessage() + } + + // First takes the first message in a sequence that results in a match for + // the given substitution arguments. + handlers[msgFirst] = func(d *Decoder) bool { + for !d.Done() { + if d.ExecuteMessage() { + return true + } + } + return false + } + + handlers[msgRaw] = func(d *Decoder) bool { + d.Render(d.data) + return true + } + + // A String message alternates between a string constant and a variable + // substitution. + handlers[msgString] = func(d *Decoder) bool { + for !d.Done() { + if str := d.DecodeString(); str != "" { + d.Render(str) + } + if d.Done() { + break + } + d.ExecuteSubstitution() + } + return true + } + + handlers[msgAffix] = func(d *Decoder) bool { + // TODO: use an alternative method for common cases. + prefix := d.DecodeString() + suffix := d.DecodeString() + if prefix != "" { + d.Render(prefix) + } + ret := d.ExecuteMessage() + if suffix != "" { + d.Render(suffix) + } + return ret + } +} + +var ( + // ErrIncomplete indicates a compiled message does not define translations + // for all possible argument values. If this message is returned, evaluating + // a message may result in the ErrNoMatch error. + ErrIncomplete = errors.New("catmsg: incomplete message; may not give result for all inputs") + + // ErrNoMatch indicates no translation message matched the given input + // parameters when evaluating a message. + ErrNoMatch = errors.New("catmsg: no translation for inputs") +) + +// A Message holds a collection of translations for the same phrase that may +// vary based on the values of substitution arguments. +type Message interface { + // Compile encodes the format string(s) of the message as a string for later + // evaluation. + // + // The first call Compile makes on the encoder must be EncodeMessageType. + // The handle passed to this call may either be a handle returned by + // Register to encode a single custom message, or HandleFirst followed by + // a sequence of calls to EncodeMessage. + // + // Compile must return ErrIncomplete if it is possible for evaluation to + // not match any translation for a given set of formatting parameters. + // For example, selecting a translation based on plural form may not yield + // a match if the form "Other" is not one of the selectors. + // + // Compile may return any other application-specific error. For backwards + // compatibility with package like fmt, which often do not do sanity + // checking of format strings ahead of time, Compile should still make an + // effort to have some sensible fallback in case of an error. + Compile(e *Encoder) error +} + +// Compile converts a Message to a data string that can be stored in a Catalog. +// The resulting string can subsequently be decoded by passing to the Execute +// method of a Decoder. +func Compile(tag language.Tag, macros Dictionary, m Message) (data string, err error) { + // TODO: pass macros so they can be used for validation. + v := &Encoder{inBody: true} // encoder for variables + v.root = v + e := &Encoder{root: v, parent: v, tag: tag} // encoder for messages + err = m.Compile(e) + // This package serves te message package, which in turn is meant to be a + // drop-in replacement for fmt. With the fmt package, format strings are + // evaluated lazily and errors are handled by substituting strings in the + // result, rather then returning an error. Dealing with multiple languages + // makes it more important to check errors ahead of time. We chose to be + // consistent and compatible and allow graceful degradation in case of + // errors. + buf := e.buf[stripPrefix(e.buf):] + if len(v.buf) > 0 { + // Prepend variable block. + b := make([]byte, 1+maxVarintBytes+len(v.buf)+len(buf)) + b[0] = byte(msgVars) + b = b[:1+encodeUint(b[1:], uint64(len(v.buf)))] + b = append(b, v.buf...) + b = append(b, buf...) + buf = b + } + if err == nil { + err = v.err + } + return string(buf), err +} + +// FirstOf is a message type that prints the first message in the sequence that +// resolves to a match for the given substitution arguments. +type FirstOf []Message + +// Compile implements Message. +func (s FirstOf) Compile(e *Encoder) error { + e.EncodeMessageType(msgFirst) + err := ErrIncomplete + for i, m := range s { + if err == nil { + return fmt.Errorf("catalog: message argument %d is complete and blocks subsequent messages", i-1) + } + err = e.EncodeMessage(m) + } + return err +} + +// Var defines a message that can be substituted for a placeholder of the same +// name. If an expression does not result in a string after evaluation, Name is +// used as the substitution. For example: +// +// Var{ +// Name: "minutes", +// Message: plural.Select(1, "one", "minute"), +// } +// +// will resolve to minute for singular and minutes for plural forms. +type Var struct { + Name string + Message Message +} + +var errIsVar = errors.New("catmsg: variable used as message") + +// Compile implements Message. +// +// Note that this method merely registers a variable; it does not create an +// encoded message. +func (v *Var) Compile(e *Encoder) error { + if err := e.addVar(v.Name, v.Message); err != nil { + return err + } + // Using a Var by itself is an error. If it is in a sequence followed by + // other messages referring to it, this error will be ignored. + return errIsVar +} + +// Raw is a message consisting of a single format string that is passed as is +// to the Renderer. +// +// Note that a Renderer may still do its own variable substitution. +type Raw string + +// Compile implements Message. +func (r Raw) Compile(e *Encoder) (err error) { + e.EncodeMessageType(msgRaw) + // Special case: raw strings don't have a size encoding and so don't use + // EncodeString. + e.buf = append(e.buf, r...) + return nil +} + +// String is a message consisting of a single format string which contains +// placeholders that may be substituted with variables. +// +// Variable substitutions are marked with placeholders and a variable name of +// the form ${name}. Any other substitutions such as Go templates or +// printf-style substitutions are left to be done by the Renderer. +// +// When evaluation a string interpolation, a Renderer will receive separate +// calls for each placeholder and interstitial string. For example, for the +// message: "%[1]v ${invites} %[2]v to ${their} party." The sequence of calls +// is: +// +// d.Render("%[1]v ") +// d.Arg(1) +// d.Render(resultOfInvites) +// d.Render(" %[2]v to ") +// d.Arg(2) +// d.Render(resultOfTheir) +// d.Render(" party.") +// +// where the messages for "invites" and "their" both use a plural.Select +// referring to the first argument. +// +// Strings may also invoke macros. Macros are essentially variables that can be +// reused. Macros may, for instance, be used to make selections between +// different conjugations of a verb. See the catalog package description for an +// overview of macros. +type String string + +// Compile implements Message. It parses the placeholder formats and returns +// any error. +func (s String) Compile(e *Encoder) (err error) { + msg := string(s) + const subStart = "${" + hasHeader := false + p := 0 + b := []byte{} + for { + i := strings.Index(msg[p:], subStart) + if i == -1 { + break + } + b = append(b, msg[p:p+i]...) + p += i + len(subStart) + if i = strings.IndexByte(msg[p:], '}'); i == -1 { + b = append(b, "$!(MISSINGBRACE)"...) + err = fmt.Errorf("catmsg: missing '}'") + p = len(msg) + break + } + name := strings.TrimSpace(msg[p : p+i]) + if q := strings.IndexByte(name, '('); q == -1 { + if !hasHeader { + hasHeader = true + e.EncodeMessageType(msgString) + } + e.EncodeString(string(b)) + e.EncodeSubstitution(name) + b = b[:0] + } else if j := strings.IndexByte(name[q:], ')'); j == -1 { + // TODO: what should the error be? + b = append(b, "$!(MISSINGPAREN)"...) + err = fmt.Errorf("catmsg: missing ')'") + } else if x, sErr := strconv.ParseUint(strings.TrimSpace(name[q+1:q+j]), 10, 32); sErr != nil { + // TODO: handle more than one argument + b = append(b, "$!(BADNUM)"...) + err = fmt.Errorf("catmsg: invalid number %q", strings.TrimSpace(name[q+1:q+j])) + } else { + if !hasHeader { + hasHeader = true + e.EncodeMessageType(msgString) + } + e.EncodeString(string(b)) + e.EncodeSubstitution(name[:q], int(x)) + b = b[:0] + } + p += i + 1 + } + b = append(b, msg[p:]...) + if !hasHeader { + // Simplify string to a raw string. + Raw(string(b)).Compile(e) + } else if len(b) > 0 { + e.EncodeString(string(b)) + } + return err +} + +// Affix is a message that adds a prefix and suffix to another message. +// This is mostly used add back whitespace to a translation that was stripped +// before sending it out. +type Affix struct { + Message Message + Prefix string + Suffix string +} + +// Compile implements Message. +func (a Affix) Compile(e *Encoder) (err error) { + // TODO: consider adding a special message type that just adds a single + // return. This is probably common enough to handle the majority of cases. + // Get some stats first, though. + e.EncodeMessageType(msgAffix) + e.EncodeString(a.Prefix) + e.EncodeString(a.Suffix) + e.EncodeMessage(a.Message) + return nil +} diff --git a/vendor/golang.org/x/text/internal/catmsg/codec.go b/vendor/golang.org/x/text/internal/catmsg/codec.go new file mode 100644 index 0000000..49c9fc9 --- /dev/null +++ b/vendor/golang.org/x/text/internal/catmsg/codec.go @@ -0,0 +1,407 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package catmsg + +import ( + "errors" + "fmt" + + "golang.org/x/text/language" +) + +// A Renderer renders a Message. +type Renderer interface { + // Render renders the given string. The given string may be interpreted as a + // format string, such as the one used by the fmt package or a template. + Render(s string) + + // Arg returns the i-th argument passed to format a message. This method + // should return nil if there is no such argument. Messages need access to + // arguments to allow selecting a message based on linguistic features of + // those arguments. + Arg(i int) interface{} +} + +// A Dictionary specifies a source of messages, including variables or macros. +type Dictionary interface { + // Lookup returns the message for the given key. It returns false for ok if + // such a message could not be found. + Lookup(key string) (data string, ok bool) + + // TODO: consider returning an interface, instead of a string. This will + // allow implementations to do their own message type decoding. +} + +// An Encoder serializes a Message to a string. +type Encoder struct { + // The root encoder is used for storing encoded variables. + root *Encoder + // The parent encoder provides the surrounding scopes for resolving variable + // names. + parent *Encoder + + tag language.Tag + + // buf holds the encoded message so far. After a message completes encoding, + // the contents of buf, prefixed by the encoded length, are flushed to the + // parent buffer. + buf []byte + + // vars is the lookup table of variables in the current scope. + vars []keyVal + + err error + inBody bool // if false next call must be EncodeMessageType +} + +type keyVal struct { + key string + offset int +} + +// Language reports the language for which the encoded message will be stored +// in the Catalog. +func (e *Encoder) Language() language.Tag { return e.tag } + +func (e *Encoder) setError(err error) { + if e.root.err == nil { + e.root.err = err + } +} + +// EncodeUint encodes x. +func (e *Encoder) EncodeUint(x uint64) { + e.checkInBody() + var buf [maxVarintBytes]byte + n := encodeUint(buf[:], x) + e.buf = append(e.buf, buf[:n]...) +} + +// EncodeString encodes s. +func (e *Encoder) EncodeString(s string) { + e.checkInBody() + e.EncodeUint(uint64(len(s))) + e.buf = append(e.buf, s...) +} + +// EncodeMessageType marks the current message to be of type h. +// +// It must be the first call of a Message's Compile method. +func (e *Encoder) EncodeMessageType(h Handle) { + if e.inBody { + panic("catmsg: EncodeMessageType not the first method called") + } + e.inBody = true + e.EncodeUint(uint64(h)) +} + +// EncodeMessage serializes the given message inline at the current position. +func (e *Encoder) EncodeMessage(m Message) error { + e = &Encoder{root: e.root, parent: e, tag: e.tag} + err := m.Compile(e) + if _, ok := m.(*Var); !ok { + e.flushTo(e.parent) + } + return err +} + +func (e *Encoder) checkInBody() { + if !e.inBody { + panic("catmsg: expected prior call to EncodeMessageType") + } +} + +// stripPrefix indicates the number of prefix bytes that must be stripped to +// turn a single-element sequence into a message that is just this single member +// without its size prefix. If the message can be stripped, b[1:n] contains the +// size prefix. +func stripPrefix(b []byte) (n int) { + if len(b) > 0 && Handle(b[0]) == msgFirst { + x, n, _ := decodeUint(b[1:]) + if 1+n+int(x) == len(b) { + return 1 + n + } + } + return 0 +} + +func (e *Encoder) flushTo(dst *Encoder) { + data := e.buf + p := stripPrefix(data) + if p > 0 { + data = data[1:] + } else { + // Prefix the size. + dst.EncodeUint(uint64(len(data))) + } + dst.buf = append(dst.buf, data...) +} + +func (e *Encoder) addVar(key string, m Message) error { + for _, v := range e.parent.vars { + if v.key == key { + err := fmt.Errorf("catmsg: duplicate variable %q", key) + e.setError(err) + return err + } + } + scope := e.parent + // If a variable message is Incomplete, and does not evaluate to a message + // during execution, we fall back to the variable name. We encode this by + // appending the variable name if the message reports it's incomplete. + + err := m.Compile(e) + if err != ErrIncomplete { + e.setError(err) + } + switch { + case len(e.buf) == 1 && Handle(e.buf[0]) == msgFirst: // empty sequence + e.buf = e.buf[:0] + e.inBody = false + fallthrough + case len(e.buf) == 0: + // Empty message. + if err := String(key).Compile(e); err != nil { + e.setError(err) + } + case err == ErrIncomplete: + if Handle(e.buf[0]) != msgFirst { + seq := &Encoder{root: e.root, parent: e} + seq.EncodeMessageType(msgFirst) + e.flushTo(seq) + e = seq + } + // e contains a sequence; append the fallback string. + e.EncodeMessage(String(key)) + } + + // Flush result to variable heap. + offset := len(e.root.buf) + e.flushTo(e.root) + e.buf = e.buf[:0] + + // Record variable offset in current scope. + scope.vars = append(scope.vars, keyVal{key: key, offset: offset}) + return err +} + +const ( + substituteVar = iota + substituteMacro + substituteError +) + +// EncodeSubstitution inserts a resolved reference to a variable or macro. +// +// This call must be matched with a call to ExecuteSubstitution at decoding +// time. +func (e *Encoder) EncodeSubstitution(name string, arguments ...int) { + if arity := len(arguments); arity > 0 { + // TODO: also resolve macros. + e.EncodeUint(substituteMacro) + e.EncodeString(name) + for _, a := range arguments { + e.EncodeUint(uint64(a)) + } + return + } + for scope := e; scope != nil; scope = scope.parent { + for _, v := range scope.vars { + if v.key != name { + continue + } + e.EncodeUint(substituteVar) // TODO: support arity > 0 + e.EncodeUint(uint64(v.offset)) + return + } + } + // TODO: refer to dictionary-wide scoped variables. + e.EncodeUint(substituteError) + e.EncodeString(name) + e.setError(fmt.Errorf("catmsg: unknown var %q", name)) +} + +// A Decoder deserializes and evaluates messages that are encoded by an encoder. +type Decoder struct { + tag language.Tag + dst Renderer + macros Dictionary + + err error + vars string + data string + + macroArg int // TODO: allow more than one argument +} + +// NewDecoder returns a new Decoder. +// +// Decoders are designed to be reused for multiple invocations of Execute. +// Only one goroutine may call Execute concurrently. +func NewDecoder(tag language.Tag, r Renderer, macros Dictionary) *Decoder { + return &Decoder{ + tag: tag, + dst: r, + macros: macros, + } +} + +func (d *Decoder) setError(err error) { + if d.err == nil { + d.err = err + } +} + +// Language returns the language in which the message is being rendered. +// +// The destination language may be a child language of the language used for +// encoding. For instance, a decoding language of "pt-PT"" is consistent with an +// encoding language of "pt". +func (d *Decoder) Language() language.Tag { return d.tag } + +// Done reports whether there are more bytes to process in this message. +func (d *Decoder) Done() bool { return len(d.data) == 0 } + +// Render implements Renderer. +func (d *Decoder) Render(s string) { d.dst.Render(s) } + +// Arg implements Renderer. +// +// During evaluation of macros, the argument positions may be mapped to +// arguments that differ from the original call. +func (d *Decoder) Arg(i int) interface{} { + if d.macroArg != 0 { + if i != 1 { + panic("catmsg: only macros with single argument supported") + } + i = d.macroArg + } + return d.dst.Arg(i) +} + +// DecodeUint decodes a number that was encoded with EncodeUint and advances the +// position. +func (d *Decoder) DecodeUint() uint64 { + x, n, err := decodeUintString(d.data) + d.data = d.data[n:] + if err != nil { + d.setError(err) + } + return x +} + +// DecodeString decodes a string that was encoded with EncodeString and advances +// the position. +func (d *Decoder) DecodeString() string { + size := d.DecodeUint() + s := d.data[:size] + d.data = d.data[size:] + return s +} + +// SkipMessage skips the message at the current location and advances the +// position. +func (d *Decoder) SkipMessage() { + n := int(d.DecodeUint()) + d.data = d.data[n:] +} + +// Execute decodes and evaluates msg. +// +// Only one goroutine may call execute. +func (d *Decoder) Execute(msg string) error { + d.err = nil + if !d.execute(msg) { + return ErrNoMatch + } + return d.err +} + +func (d *Decoder) execute(msg string) bool { + saved := d.data + d.data = msg + ok := d.executeMessage() + d.data = saved + return ok +} + +// executeMessageFromData is like execute, but also decodes a leading message +// size and clips the given string accordingly. +// +// It reports the number of bytes consumed and whether a message was selected. +func (d *Decoder) executeMessageFromData(s string) (n int, ok bool) { + saved := d.data + d.data = s + size := int(d.DecodeUint()) + n = len(s) - len(d.data) + // Sanitize the setting. This allows skipping a size argument for + // RawString and method Done. + d.data = d.data[:size] + ok = d.executeMessage() + n += size - len(d.data) + d.data = saved + return n, ok +} + +var errUnknownHandler = errors.New("catmsg: string contains unsupported handler") + +// executeMessage reads the handle id, initializes the decoder and executes the +// message. It is assumed that all of d.data[d.p:] is the single message. +func (d *Decoder) executeMessage() bool { + if d.Done() { + // We interpret no data as a valid empty message. + return true + } + handle := d.DecodeUint() + + var fn Handler + mutex.Lock() + if int(handle) < len(handlers) { + fn = handlers[handle] + } + mutex.Unlock() + if fn == nil { + d.setError(errUnknownHandler) + d.execute(fmt.Sprintf("\x02$!(UNKNOWNMSGHANDLER=%#x)", handle)) + return true + } + return fn(d) +} + +// ExecuteMessage decodes and executes the message at the current position. +func (d *Decoder) ExecuteMessage() bool { + n, ok := d.executeMessageFromData(d.data) + d.data = d.data[n:] + return ok +} + +// ExecuteSubstitution executes the message corresponding to the substitution +// as encoded by EncodeSubstitution. +func (d *Decoder) ExecuteSubstitution() { + switch x := d.DecodeUint(); x { + case substituteVar: + offset := d.DecodeUint() + d.executeMessageFromData(d.vars[offset:]) + case substituteMacro: + name := d.DecodeString() + data, ok := d.macros.Lookup(name) + old := d.macroArg + // TODO: support macros of arity other than 1. + d.macroArg = int(d.DecodeUint()) + switch { + case !ok: + // TODO: detect this at creation time. + d.setError(fmt.Errorf("catmsg: undefined macro %q", name)) + fallthrough + case !d.execute(data): + d.dst.Render(name) // fall back to macro name. + } + d.macroArg = old + case substituteError: + d.dst.Render(d.DecodeString()) + default: + panic("catmsg: unreachable") + } +} diff --git a/vendor/golang.org/x/text/internal/catmsg/varint.go b/vendor/golang.org/x/text/internal/catmsg/varint.go new file mode 100644 index 0000000..a2cee2c --- /dev/null +++ b/vendor/golang.org/x/text/internal/catmsg/varint.go @@ -0,0 +1,62 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package catmsg + +// This file implements varint encoding analogous to the one in encoding/binary. +// We need a string version of this function, so we add that here and then add +// the rest for consistency. + +import "errors" + +var ( + errIllegalVarint = errors.New("catmsg: illegal varint") + errVarintTooLarge = errors.New("catmsg: varint too large for uint64") +) + +const maxVarintBytes = 10 // maximum length of a varint + +// encodeUint encodes x as a variable-sized integer into buf and returns the +// number of bytes written. buf must be at least maxVarintBytes long +func encodeUint(buf []byte, x uint64) (n int) { + for ; x > 127; n++ { + buf[n] = 0x80 | uint8(x&0x7F) + x >>= 7 + } + buf[n] = uint8(x) + n++ + return n +} + +func decodeUintString(s string) (x uint64, size int, err error) { + i := 0 + for shift := uint(0); shift < 64; shift += 7 { + if i >= len(s) { + return 0, i, errIllegalVarint + } + b := uint64(s[i]) + i++ + x |= (b & 0x7F) << shift + if b&0x80 == 0 { + return x, i, nil + } + } + return 0, i, errVarintTooLarge +} + +func decodeUint(b []byte) (x uint64, size int, err error) { + i := 0 + for shift := uint(0); shift < 64; shift += 7 { + if i >= len(b) { + return 0, i, errIllegalVarint + } + c := uint64(b[i]) + i++ + x |= (c & 0x7F) << shift + if c&0x80 == 0 { + return x, i, nil + } + } + return 0, i, errVarintTooLarge +} diff --git a/vendor/golang.org/x/text/internal/format/format.go b/vendor/golang.org/x/text/internal/format/format.go new file mode 100644 index 0000000..ee1c57a --- /dev/null +++ b/vendor/golang.org/x/text/internal/format/format.go @@ -0,0 +1,41 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package format contains types for defining language-specific formatting of +// values. +// +// This package is internal now, but will eventually be exposed after the API +// settles. +package format // import "golang.org/x/text/internal/format" + +import ( + "fmt" + + "golang.org/x/text/language" +) + +// State represents the printer state passed to custom formatters. It provides +// access to the fmt.State interface and the sentence and language-related +// context. +type State interface { + fmt.State + + // Language reports the requested language in which to render a message. + Language() language.Tag + + // TODO: consider this and removing rune from the Format method in the + // Formatter interface. + // + // Verb returns the format variant to render, analogous to the types used + // in fmt. Use 'v' for the default or only variant. + // Verb() rune + + // TODO: more info: + // - sentence context such as linguistic features passed by the translator. +} + +// Formatter is analogous to fmt.Formatter. +type Formatter interface { + Format(state State, verb rune) +} diff --git a/vendor/golang.org/x/text/internal/format/parser.go b/vendor/golang.org/x/text/internal/format/parser.go new file mode 100644 index 0000000..855aed7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/format/parser.go @@ -0,0 +1,358 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package format + +import ( + "reflect" + "unicode/utf8" +) + +// A Parser parses a format string. The result from the parse are set in the +// struct fields. +type Parser struct { + Verb rune + + WidthPresent bool + PrecPresent bool + Minus bool + Plus bool + Sharp bool + Space bool + Zero bool + + // For the formats %+v %#v, we set the plusV/sharpV flags + // and clear the plus/sharp flags since %+v and %#v are in effect + // different, flagless formats set at the top level. + PlusV bool + SharpV bool + + HasIndex bool + + Width int + Prec int // precision + + // retain arguments across calls. + Args []interface{} + // retain current argument number across calls + ArgNum int + + // reordered records whether the format string used argument reordering. + Reordered bool + // goodArgNum records whether the most recent reordering directive was valid. + goodArgNum bool + + // position info + format string + startPos int + endPos int + Status Status +} + +// Reset initializes a parser to scan format strings for the given args. +func (p *Parser) Reset(args []interface{}) { + p.Args = args + p.ArgNum = 0 + p.startPos = 0 + p.Reordered = false +} + +// Text returns the part of the format string that was parsed by the last call +// to Scan. It returns the original substitution clause if the current scan +// parsed a substitution. +func (p *Parser) Text() string { return p.format[p.startPos:p.endPos] } + +// SetFormat sets a new format string to parse. It does not reset the argument +// count. +func (p *Parser) SetFormat(format string) { + p.format = format + p.startPos = 0 + p.endPos = 0 +} + +// Status indicates the result type of a call to Scan. +type Status int + +const ( + StatusText Status = iota + StatusSubstitution + StatusBadWidthSubstitution + StatusBadPrecSubstitution + StatusNoVerb + StatusBadArgNum + StatusMissingArg +) + +// ClearFlags reset the parser to default behavior. +func (p *Parser) ClearFlags() { + p.WidthPresent = false + p.PrecPresent = false + p.Minus = false + p.Plus = false + p.Sharp = false + p.Space = false + p.Zero = false + + p.PlusV = false + p.SharpV = false + + p.HasIndex = false +} + +// Scan scans the next part of the format string and sets the status to +// indicate whether it scanned a string literal, substitution or error. +func (p *Parser) Scan() bool { + p.Status = StatusText + format := p.format + end := len(format) + if p.endPos >= end { + return false + } + afterIndex := false // previous item in format was an index like [3]. + + p.startPos = p.endPos + p.goodArgNum = true + i := p.startPos + for i < end && format[i] != '%' { + i++ + } + if i > p.startPos { + p.endPos = i + return true + } + // Process one verb + i++ + + p.Status = StatusSubstitution + + // Do we have flags? + p.ClearFlags() + +simpleFormat: + for ; i < end; i++ { + c := p.format[i] + switch c { + case '#': + p.Sharp = true + case '0': + p.Zero = !p.Minus // Only allow zero padding to the left. + case '+': + p.Plus = true + case '-': + p.Minus = true + p.Zero = false // Do not pad with zeros to the right. + case ' ': + p.Space = true + default: + // Fast path for common case of ascii lower case simple verbs + // without precision or width or argument indices. + if 'a' <= c && c <= 'z' && p.ArgNum < len(p.Args) { + if c == 'v' { + // Go syntax + p.SharpV = p.Sharp + p.Sharp = false + // Struct-field syntax + p.PlusV = p.Plus + p.Plus = false + } + p.Verb = rune(c) + p.ArgNum++ + p.endPos = i + 1 + return true + } + // Format is more complex than simple flags and a verb or is malformed. + break simpleFormat + } + } + + // Do we have an explicit argument index? + i, afterIndex = p.updateArgNumber(format, i) + + // Do we have width? + if i < end && format[i] == '*' { + i++ + p.Width, p.WidthPresent = p.intFromArg() + + if !p.WidthPresent { + p.Status = StatusBadWidthSubstitution + } + + // We have a negative width, so take its value and ensure + // that the minus flag is set + if p.Width < 0 { + p.Width = -p.Width + p.Minus = true + p.Zero = false // Do not pad with zeros to the right. + } + afterIndex = false + } else { + p.Width, p.WidthPresent, i = parsenum(format, i, end) + if afterIndex && p.WidthPresent { // "%[3]2d" + p.goodArgNum = false + } + } + + // Do we have precision? + if i+1 < end && format[i] == '.' { + i++ + if afterIndex { // "%[3].2d" + p.goodArgNum = false + } + i, afterIndex = p.updateArgNumber(format, i) + if i < end && format[i] == '*' { + i++ + p.Prec, p.PrecPresent = p.intFromArg() + // Negative precision arguments don't make sense + if p.Prec < 0 { + p.Prec = 0 + p.PrecPresent = false + } + if !p.PrecPresent { + p.Status = StatusBadPrecSubstitution + } + afterIndex = false + } else { + p.Prec, p.PrecPresent, i = parsenum(format, i, end) + if !p.PrecPresent { + p.Prec = 0 + p.PrecPresent = true + } + } + } + + if !afterIndex { + i, afterIndex = p.updateArgNumber(format, i) + } + p.HasIndex = afterIndex + + if i >= end { + p.endPos = i + p.Status = StatusNoVerb + return true + } + + verb, w := utf8.DecodeRuneInString(format[i:]) + p.endPos = i + w + p.Verb = verb + + switch { + case verb == '%': // Percent does not absorb operands and ignores f.wid and f.prec. + p.startPos = p.endPos - 1 + p.Status = StatusText + case !p.goodArgNum: + p.Status = StatusBadArgNum + case p.ArgNum >= len(p.Args): // No argument left over to print for the current verb. + p.Status = StatusMissingArg + p.ArgNum++ + case verb == 'v': + // Go syntax + p.SharpV = p.Sharp + p.Sharp = false + // Struct-field syntax + p.PlusV = p.Plus + p.Plus = false + fallthrough + default: + p.ArgNum++ + } + return true +} + +// intFromArg gets the ArgNumth element of Args. On return, isInt reports +// whether the argument has integer type. +func (p *Parser) intFromArg() (num int, isInt bool) { + if p.ArgNum < len(p.Args) { + arg := p.Args[p.ArgNum] + num, isInt = arg.(int) // Almost always OK. + if !isInt { + // Work harder. + switch v := reflect.ValueOf(arg); v.Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + n := v.Int() + if int64(int(n)) == n { + num = int(n) + isInt = true + } + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + n := v.Uint() + if int64(n) >= 0 && uint64(int(n)) == n { + num = int(n) + isInt = true + } + default: + // Already 0, false. + } + } + p.ArgNum++ + if tooLarge(num) { + num = 0 + isInt = false + } + } + return +} + +// parseArgNumber returns the value of the bracketed number, minus 1 +// (explicit argument numbers are one-indexed but we want zero-indexed). +// The opening bracket is known to be present at format[0]. +// The returned values are the index, the number of bytes to consume +// up to the closing paren, if present, and whether the number parsed +// ok. The bytes to consume will be 1 if no closing paren is present. +func parseArgNumber(format string) (index int, wid int, ok bool) { + // There must be at least 3 bytes: [n]. + if len(format) < 3 { + return 0, 1, false + } + + // Find closing bracket. + for i := 1; i < len(format); i++ { + if format[i] == ']' { + width, ok, newi := parsenum(format, 1, i) + if !ok || newi != i { + return 0, i + 1, false + } + return width - 1, i + 1, true // arg numbers are one-indexed and skip paren. + } + } + return 0, 1, false +} + +// updateArgNumber returns the next argument to evaluate, which is either the value of the passed-in +// argNum or the value of the bracketed integer that begins format[i:]. It also returns +// the new value of i, that is, the index of the next byte of the format to process. +func (p *Parser) updateArgNumber(format string, i int) (newi int, found bool) { + if len(format) <= i || format[i] != '[' { + return i, false + } + p.Reordered = true + index, wid, ok := parseArgNumber(format[i:]) + if ok && 0 <= index && index < len(p.Args) { + p.ArgNum = index + return i + wid, true + } + p.goodArgNum = false + return i + wid, ok +} + +// tooLarge reports whether the magnitude of the integer is +// too large to be used as a formatting width or precision. +func tooLarge(x int) bool { + const max int = 1e6 + return x > max || x < -max +} + +// parsenum converts ASCII to integer. num is 0 (and isnum is false) if no number present. +func parsenum(s string, start, end int) (num int, isnum bool, newi int) { + if start >= end { + return 0, false, end + } + for newi = start; newi < end && '0' <= s[newi] && s[newi] <= '9'; newi++ { + if tooLarge(num) { + return 0, false, end // Overflow; crazy long number most likely. + } + num = num*10 + int(s[newi]-'0') + isnum = true + } + return +} diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go new file mode 100644 index 0000000..3cddbbd --- /dev/null +++ b/vendor/golang.org/x/text/internal/internal.go @@ -0,0 +1,49 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package internal contains non-exported functionality that are used by +// packages in the text repository. +package internal // import "golang.org/x/text/internal" + +import ( + "sort" + + "golang.org/x/text/language" +) + +// SortTags sorts tags in place. +func SortTags(tags []language.Tag) { + sort.Sort(sorter(tags)) +} + +type sorter []language.Tag + +func (s sorter) Len() int { + return len(s) +} + +func (s sorter) Swap(i, j int) { + s[i], s[j] = s[j], s[i] +} + +func (s sorter) Less(i, j int) bool { + return s[i].String() < s[j].String() +} + +// UniqueTags sorts and filters duplicate tags in place and returns a slice with +// only unique tags. +func UniqueTags(tags []language.Tag) []language.Tag { + if len(tags) <= 1 { + return tags + } + SortTags(tags) + k := 0 + for i := 1; i < len(tags); i++ { + if tags[k].String() < tags[i].String() { + k++ + tags[k] = tags[i] + } + } + return tags[:k+1] +} diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go new file mode 100644 index 0000000..cdfdb74 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/common.go @@ -0,0 +1,16 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// This file contains code common to the maketables.go and the package code. + +// AliasType is the type of an alias in AliasMap. +type AliasType int8 + +const ( + Deprecated AliasType = iota + Macro + Legacy + + AliasTypeUnknown AliasType = -1 +) diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go new file mode 100644 index 0000000..46a0015 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact.go @@ -0,0 +1,29 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// CompactCoreInfo is a compact integer with the three core tags encoded. +type CompactCoreInfo uint32 + +// GetCompactCore generates a uint32 value that is guaranteed to be unique for +// different language, region, and script values. +func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { + if t.LangID > langNoIndexOffset { + return 0, false + } + cci |= CompactCoreInfo(t.LangID) << (8 + 12) + cci |= CompactCoreInfo(t.ScriptID) << 12 + cci |= CompactCoreInfo(t.RegionID) + return cci, true +} + +// Tag generates a tag from c. +func (c CompactCoreInfo) Tag() Tag { + return Tag{ + LangID: Language(c >> 20), + RegionID: Region(c & 0x3ff), + ScriptID: Script(c>>12) & 0xff, + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go new file mode 100644 index 0000000..1b36935 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/compact.go @@ -0,0 +1,61 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package compact defines a compact representation of language tags. +// +// Common language tags (at least all for which locale information is defined +// in CLDR) are assigned a unique index. Each Tag is associated with such an +// ID for selecting language-related resources (such as translations) as well +// as one for selecting regional defaults (currency, number formatting, etc.) +// +// It may want to export this functionality at some point, but at this point +// this is only available for use within x/text. +package compact // import "golang.org/x/text/internal/language/compact" + +import ( + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// ID is an integer identifying a single tag. +type ID uint16 + +func getCoreIndex(t language.Tag) (id ID, ok bool) { + cci, ok := language.GetCompactCore(t) + if !ok { + return 0, false + } + i := sort.Search(len(coreTags), func(i int) bool { + return cci <= coreTags[i] + }) + if i == len(coreTags) || coreTags[i] != cci { + return 0, false + } + return ID(i), true +} + +// Parent returns the ID of the parent or the root ID if id is already the root. +func (id ID) Parent() ID { + return parents[id] +} + +// Tag converts id to an internal language Tag. +func (id ID) Tag() language.Tag { + if int(id) >= len(coreTags) { + return specialTags[int(id)-len(coreTags)] + } + return coreTags[id].Tag() +} + +var specialTags []language.Tag + +func init() { + tags := strings.Split(specialTagsStr, " ") + specialTags = make([]language.Tag, len(tags)) + for i, t := range tags { + specialTags[i] = language.MustParse(t) + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go new file mode 100644 index 0000000..8c1b666 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -0,0 +1,260 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_index.go -output tables.go +//go:generate go run gen_parents.go + +package compact + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag struct { + // NOTE: exported tags will become part of the public API. + language ID + locale ID + full fullTag // always a language.Tag for now. +} + +const _und = 0 + +type fullTag interface { + IsRoot() bool + Parent() language.Tag +} + +// Make a compact Tag from a fully specified internal language Tag. +func Make(t language.Tag) (tag Tag) { + if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { + if r, err := language.ParseRegion(region[:2]); err == nil { + tFull := t + t, _ = t.SetTypeForKey("rg", "") + // TODO: should we not consider "va" for the language tag? + var exact1, exact2 bool + tag.language, exact1 = FromTag(t) + t.RegionID = r + tag.locale, exact2 = FromTag(t) + if !exact1 || !exact2 { + tag.full = tFull + } + return tag + } + } + lang, ok := FromTag(t) + tag.language = lang + tag.locale = lang + if !ok { + tag.full = t + } + return tag +} + +// Tag returns an internal language Tag version of this tag. +func (t Tag) Tag() language.Tag { + if t.full != nil { + return t.full.(language.Tag) + } + tag := t.language.Tag() + if t.language != t.locale { + loc := t.locale.Tag() + tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") + } + return tag +} + +// IsCompact reports whether this tag is fully defined in terms of ID. +func (t *Tag) IsCompact() bool { + return t.full == nil +} + +// MayHaveVariants reports whether a tag may have variants. If it returns false +// it is guaranteed the tag does not have variants. +func (t Tag) MayHaveVariants() bool { + return t.full != nil || int(t.language) >= len(coreTags) +} + +// MayHaveExtensions reports whether a tag may have extensions. If it returns +// false it is guaranteed the tag does not have them. +func (t Tag) MayHaveExtensions() bool { + return t.full != nil || + int(t.language) >= len(coreTags) || + t.language != t.locale +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if t.full != nil { + return t.full.IsRoot() + } + return t.language == _und +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.full != nil { + return Make(t.full.Parent()) + } + if t.language != t.locale { + // Simulate stripping -u-rg-xxxxxx + return Tag{language: t.language, locale: t.language} + } + // TODO: use parent lookup table once cycle from internal package is + // removed. Probably by internalizing the table and declaring this fast + // enough. + // lang := compactID(internal.Parent(uint16(t.language))) + lang, _ := FromTag(t.language.Tag().Parent()) + return Tag{language: lang, locale: lang} +} + +// nextToken returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func LanguageID(t Tag) (id ID, exact bool) { + return t.language, t.full == nil +} + +// RegionalID returns the ID for the regional variant of this tag. This index is +// used to indicate region-specific overrides, such as default currency, default +// calendar and week data, default time cycle, and default measurement system +// and unit preferences. +// +// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US +// settings for currency, number formatting, etc. The CompactIndex for this tag +// will be that for en-GB, while the RegionalID will be the one corresponding to +// en-US. +func RegionalID(t Tag) (id ID, exact bool) { + return t.locale, t.full == nil +} + +// LanguageTag returns t stripped of regional variant indicators. +// +// At the moment this means it is stripped of a regional and variant subtag "rg" +// and "va" in the "u" extension. +func (t Tag) LanguageTag() Tag { + if t.full == nil { + return Tag{language: t.language, locale: t.language} + } + tt := t.Tag() + tt.SetTypeForKey("rg", "") + tt.SetTypeForKey("va", "") + return Make(tt) +} + +// RegionalTag returns the regional variant of the tag. +// +// At the moment this means that the region is set from the regional subtag +// "rg" in the "u" extension. +func (t Tag) RegionalTag() Tag { + rt := Tag{language: t.locale, locale: t.locale} + if t.full == nil { + return rt + } + b := language.Builder{} + tag := t.Tag() + // tag, _ = tag.SetTypeForKey("rg", "") + b.SetTag(t.locale.Tag()) + if v := tag.Variants(); v != "" { + for _, v := range strings.Split(v, "-") { + b.AddVariant(v) + } + } + for _, e := range tag.Extensions() { + b.AddExt(e) + } + return t +} + +// FromTag reports closest matching ID for an internal language Tag. +func FromTag(t language.Tag) (id ID, exact bool) { + // TODO: perhaps give more frequent tags a lower index. + // TODO: we could make the indexes stable. This will excluded some + // possibilities for optimization, so don't do this quite yet. + exact = true + + b, s, r := t.Raw() + if t.HasString() { + if t.IsPrivateUse() { + // We have no entries for user-defined tags. + return 0, false + } + hasExtra := false + if t.HasVariants() { + if t.HasExtensions() { + build := language.Builder{} + build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) + build.AddVariant(t.Variants()) + exact = false + t = build.Make() + } + hasExtra = true + } else if _, ok := t.Extension('u'); ok { + // TODO: va may mean something else. Consider not considering it. + // Strip all but the 'va' entry. + old := t + variant := t.TypeForKey("va") + t = language.Tag{LangID: b, ScriptID: s, RegionID: r} + if variant != "" { + t, _ = t.SetTypeForKey("va", variant) + hasExtra = true + } + exact = old == t + } else { + exact = false + } + if hasExtra { + // We have some variants. + for i, s := range specialTags { + if s == t { + return ID(i + len(coreTags)), exact + } + } + exact = false + } + } + if x, ok := getCoreIndex(t); ok { + return x, exact + } + exact = false + if r != 0 && s == 0 { + // Deal with cases where an extra script is inserted for the region. + t, _ := t.Maximize() + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + for t = t.Parent(); t != root; t = t.Parent() { + // No variants specified: just compare core components. + // The key has the form lllssrrr, where l, s, and r are nibbles for + // respectively the langID, scriptID, and regionID. + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + return 0, exact +} + +var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go new file mode 100644 index 0000000..8d81072 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/parents.go @@ -0,0 +1,120 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +// parents maps a compact index of a tag to the compact index of the parent of +// this tag. +var parents = []ID{ // 775 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, + 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, + 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, + 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, + 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, + 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, + 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, + 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, + 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, + 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, + // Entry 80 - BF + 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, + // Entry C0 - FF + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, + 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, + 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, + // Entry 100 - 13F + 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, + 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, + 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, + 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + // Entry 140 - 17F + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, + 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, + 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, + 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, + 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, + 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, + 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, + 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, + 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, + 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, + 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, + 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, + 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, + 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, + // Entry 200 - 23F + 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, + 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, + 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, + 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, + 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, + 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, + 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, + // Entry 240 - 27F + 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, + 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, + 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, + 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, + 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, + 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, + 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, + 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, + 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, + 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, + 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, + 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, + // Entry 2C0 - 2FF + 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, + 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, + 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, + 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, + 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, + 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, + // Entry 300 - 33F + 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, +} // Size: 1574 bytes + +// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go new file mode 100644 index 0000000..a09ed19 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -0,0 +1,1015 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +import "golang.org/x/text/internal/language" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +// NumCompactTags is the number of common tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = 775 +const ( + undIndex ID = 0 + afIndex ID = 1 + afNAIndex ID = 2 + afZAIndex ID = 3 + agqIndex ID = 4 + agqCMIndex ID = 5 + akIndex ID = 6 + akGHIndex ID = 7 + amIndex ID = 8 + amETIndex ID = 9 + arIndex ID = 10 + ar001Index ID = 11 + arAEIndex ID = 12 + arBHIndex ID = 13 + arDJIndex ID = 14 + arDZIndex ID = 15 + arEGIndex ID = 16 + arEHIndex ID = 17 + arERIndex ID = 18 + arILIndex ID = 19 + arIQIndex ID = 20 + arJOIndex ID = 21 + arKMIndex ID = 22 + arKWIndex ID = 23 + arLBIndex ID = 24 + arLYIndex ID = 25 + arMAIndex ID = 26 + arMRIndex ID = 27 + arOMIndex ID = 28 + arPSIndex ID = 29 + arQAIndex ID = 30 + arSAIndex ID = 31 + arSDIndex ID = 32 + arSOIndex ID = 33 + arSSIndex ID = 34 + arSYIndex ID = 35 + arTDIndex ID = 36 + arTNIndex ID = 37 + arYEIndex ID = 38 + arsIndex ID = 39 + asIndex ID = 40 + asINIndex ID = 41 + asaIndex ID = 42 + asaTZIndex ID = 43 + astIndex ID = 44 + astESIndex ID = 45 + azIndex ID = 46 + azCyrlIndex ID = 47 + azCyrlAZIndex ID = 48 + azLatnIndex ID = 49 + azLatnAZIndex ID = 50 + basIndex ID = 51 + basCMIndex ID = 52 + beIndex ID = 53 + beBYIndex ID = 54 + bemIndex ID = 55 + bemZMIndex ID = 56 + bezIndex ID = 57 + bezTZIndex ID = 58 + bgIndex ID = 59 + bgBGIndex ID = 60 + bhIndex ID = 61 + bmIndex ID = 62 + bmMLIndex ID = 63 + bnIndex ID = 64 + bnBDIndex ID = 65 + bnINIndex ID = 66 + boIndex ID = 67 + boCNIndex ID = 68 + boINIndex ID = 69 + brIndex ID = 70 + brFRIndex ID = 71 + brxIndex ID = 72 + brxINIndex ID = 73 + bsIndex ID = 74 + bsCyrlIndex ID = 75 + bsCyrlBAIndex ID = 76 + bsLatnIndex ID = 77 + bsLatnBAIndex ID = 78 + caIndex ID = 79 + caADIndex ID = 80 + caESIndex ID = 81 + caFRIndex ID = 82 + caITIndex ID = 83 + ccpIndex ID = 84 + ccpBDIndex ID = 85 + ccpINIndex ID = 86 + ceIndex ID = 87 + ceRUIndex ID = 88 + cggIndex ID = 89 + cggUGIndex ID = 90 + chrIndex ID = 91 + chrUSIndex ID = 92 + ckbIndex ID = 93 + ckbIQIndex ID = 94 + ckbIRIndex ID = 95 + csIndex ID = 96 + csCZIndex ID = 97 + cuIndex ID = 98 + cuRUIndex ID = 99 + cyIndex ID = 100 + cyGBIndex ID = 101 + daIndex ID = 102 + daDKIndex ID = 103 + daGLIndex ID = 104 + davIndex ID = 105 + davKEIndex ID = 106 + deIndex ID = 107 + deATIndex ID = 108 + deBEIndex ID = 109 + deCHIndex ID = 110 + deDEIndex ID = 111 + deITIndex ID = 112 + deLIIndex ID = 113 + deLUIndex ID = 114 + djeIndex ID = 115 + djeNEIndex ID = 116 + dsbIndex ID = 117 + dsbDEIndex ID = 118 + duaIndex ID = 119 + duaCMIndex ID = 120 + dvIndex ID = 121 + dyoIndex ID = 122 + dyoSNIndex ID = 123 + dzIndex ID = 124 + dzBTIndex ID = 125 + ebuIndex ID = 126 + ebuKEIndex ID = 127 + eeIndex ID = 128 + eeGHIndex ID = 129 + eeTGIndex ID = 130 + elIndex ID = 131 + elCYIndex ID = 132 + elGRIndex ID = 133 + enIndex ID = 134 + en001Index ID = 135 + en150Index ID = 136 + enAGIndex ID = 137 + enAIIndex ID = 138 + enASIndex ID = 139 + enATIndex ID = 140 + enAUIndex ID = 141 + enBBIndex ID = 142 + enBEIndex ID = 143 + enBIIndex ID = 144 + enBMIndex ID = 145 + enBSIndex ID = 146 + enBWIndex ID = 147 + enBZIndex ID = 148 + enCAIndex ID = 149 + enCCIndex ID = 150 + enCHIndex ID = 151 + enCKIndex ID = 152 + enCMIndex ID = 153 + enCXIndex ID = 154 + enCYIndex ID = 155 + enDEIndex ID = 156 + enDGIndex ID = 157 + enDKIndex ID = 158 + enDMIndex ID = 159 + enERIndex ID = 160 + enFIIndex ID = 161 + enFJIndex ID = 162 + enFKIndex ID = 163 + enFMIndex ID = 164 + enGBIndex ID = 165 + enGDIndex ID = 166 + enGGIndex ID = 167 + enGHIndex ID = 168 + enGIIndex ID = 169 + enGMIndex ID = 170 + enGUIndex ID = 171 + enGYIndex ID = 172 + enHKIndex ID = 173 + enIEIndex ID = 174 + enILIndex ID = 175 + enIMIndex ID = 176 + enINIndex ID = 177 + enIOIndex ID = 178 + enJEIndex ID = 179 + enJMIndex ID = 180 + enKEIndex ID = 181 + enKIIndex ID = 182 + enKNIndex ID = 183 + enKYIndex ID = 184 + enLCIndex ID = 185 + enLRIndex ID = 186 + enLSIndex ID = 187 + enMGIndex ID = 188 + enMHIndex ID = 189 + enMOIndex ID = 190 + enMPIndex ID = 191 + enMSIndex ID = 192 + enMTIndex ID = 193 + enMUIndex ID = 194 + enMWIndex ID = 195 + enMYIndex ID = 196 + enNAIndex ID = 197 + enNFIndex ID = 198 + enNGIndex ID = 199 + enNLIndex ID = 200 + enNRIndex ID = 201 + enNUIndex ID = 202 + enNZIndex ID = 203 + enPGIndex ID = 204 + enPHIndex ID = 205 + enPKIndex ID = 206 + enPNIndex ID = 207 + enPRIndex ID = 208 + enPWIndex ID = 209 + enRWIndex ID = 210 + enSBIndex ID = 211 + enSCIndex ID = 212 + enSDIndex ID = 213 + enSEIndex ID = 214 + enSGIndex ID = 215 + enSHIndex ID = 216 + enSIIndex ID = 217 + enSLIndex ID = 218 + enSSIndex ID = 219 + enSXIndex ID = 220 + enSZIndex ID = 221 + enTCIndex ID = 222 + enTKIndex ID = 223 + enTOIndex ID = 224 + enTTIndex ID = 225 + enTVIndex ID = 226 + enTZIndex ID = 227 + enUGIndex ID = 228 + enUMIndex ID = 229 + enUSIndex ID = 230 + enVCIndex ID = 231 + enVGIndex ID = 232 + enVIIndex ID = 233 + enVUIndex ID = 234 + enWSIndex ID = 235 + enZAIndex ID = 236 + enZMIndex ID = 237 + enZWIndex ID = 238 + eoIndex ID = 239 + eo001Index ID = 240 + esIndex ID = 241 + es419Index ID = 242 + esARIndex ID = 243 + esBOIndex ID = 244 + esBRIndex ID = 245 + esBZIndex ID = 246 + esCLIndex ID = 247 + esCOIndex ID = 248 + esCRIndex ID = 249 + esCUIndex ID = 250 + esDOIndex ID = 251 + esEAIndex ID = 252 + esECIndex ID = 253 + esESIndex ID = 254 + esGQIndex ID = 255 + esGTIndex ID = 256 + esHNIndex ID = 257 + esICIndex ID = 258 + esMXIndex ID = 259 + esNIIndex ID = 260 + esPAIndex ID = 261 + esPEIndex ID = 262 + esPHIndex ID = 263 + esPRIndex ID = 264 + esPYIndex ID = 265 + esSVIndex ID = 266 + esUSIndex ID = 267 + esUYIndex ID = 268 + esVEIndex ID = 269 + etIndex ID = 270 + etEEIndex ID = 271 + euIndex ID = 272 + euESIndex ID = 273 + ewoIndex ID = 274 + ewoCMIndex ID = 275 + faIndex ID = 276 + faAFIndex ID = 277 + faIRIndex ID = 278 + ffIndex ID = 279 + ffCMIndex ID = 280 + ffGNIndex ID = 281 + ffMRIndex ID = 282 + ffSNIndex ID = 283 + fiIndex ID = 284 + fiFIIndex ID = 285 + filIndex ID = 286 + filPHIndex ID = 287 + foIndex ID = 288 + foDKIndex ID = 289 + foFOIndex ID = 290 + frIndex ID = 291 + frBEIndex ID = 292 + frBFIndex ID = 293 + frBIIndex ID = 294 + frBJIndex ID = 295 + frBLIndex ID = 296 + frCAIndex ID = 297 + frCDIndex ID = 298 + frCFIndex ID = 299 + frCGIndex ID = 300 + frCHIndex ID = 301 + frCIIndex ID = 302 + frCMIndex ID = 303 + frDJIndex ID = 304 + frDZIndex ID = 305 + frFRIndex ID = 306 + frGAIndex ID = 307 + frGFIndex ID = 308 + frGNIndex ID = 309 + frGPIndex ID = 310 + frGQIndex ID = 311 + frHTIndex ID = 312 + frKMIndex ID = 313 + frLUIndex ID = 314 + frMAIndex ID = 315 + frMCIndex ID = 316 + frMFIndex ID = 317 + frMGIndex ID = 318 + frMLIndex ID = 319 + frMQIndex ID = 320 + frMRIndex ID = 321 + frMUIndex ID = 322 + frNCIndex ID = 323 + frNEIndex ID = 324 + frPFIndex ID = 325 + frPMIndex ID = 326 + frREIndex ID = 327 + frRWIndex ID = 328 + frSCIndex ID = 329 + frSNIndex ID = 330 + frSYIndex ID = 331 + frTDIndex ID = 332 + frTGIndex ID = 333 + frTNIndex ID = 334 + frVUIndex ID = 335 + frWFIndex ID = 336 + frYTIndex ID = 337 + furIndex ID = 338 + furITIndex ID = 339 + fyIndex ID = 340 + fyNLIndex ID = 341 + gaIndex ID = 342 + gaIEIndex ID = 343 + gdIndex ID = 344 + gdGBIndex ID = 345 + glIndex ID = 346 + glESIndex ID = 347 + gswIndex ID = 348 + gswCHIndex ID = 349 + gswFRIndex ID = 350 + gswLIIndex ID = 351 + guIndex ID = 352 + guINIndex ID = 353 + guwIndex ID = 354 + guzIndex ID = 355 + guzKEIndex ID = 356 + gvIndex ID = 357 + gvIMIndex ID = 358 + haIndex ID = 359 + haGHIndex ID = 360 + haNEIndex ID = 361 + haNGIndex ID = 362 + hawIndex ID = 363 + hawUSIndex ID = 364 + heIndex ID = 365 + heILIndex ID = 366 + hiIndex ID = 367 + hiINIndex ID = 368 + hrIndex ID = 369 + hrBAIndex ID = 370 + hrHRIndex ID = 371 + hsbIndex ID = 372 + hsbDEIndex ID = 373 + huIndex ID = 374 + huHUIndex ID = 375 + hyIndex ID = 376 + hyAMIndex ID = 377 + idIndex ID = 378 + idIDIndex ID = 379 + igIndex ID = 380 + igNGIndex ID = 381 + iiIndex ID = 382 + iiCNIndex ID = 383 + inIndex ID = 384 + ioIndex ID = 385 + isIndex ID = 386 + isISIndex ID = 387 + itIndex ID = 388 + itCHIndex ID = 389 + itITIndex ID = 390 + itSMIndex ID = 391 + itVAIndex ID = 392 + iuIndex ID = 393 + iwIndex ID = 394 + jaIndex ID = 395 + jaJPIndex ID = 396 + jboIndex ID = 397 + jgoIndex ID = 398 + jgoCMIndex ID = 399 + jiIndex ID = 400 + jmcIndex ID = 401 + jmcTZIndex ID = 402 + jvIndex ID = 403 + jwIndex ID = 404 + kaIndex ID = 405 + kaGEIndex ID = 406 + kabIndex ID = 407 + kabDZIndex ID = 408 + kajIndex ID = 409 + kamIndex ID = 410 + kamKEIndex ID = 411 + kcgIndex ID = 412 + kdeIndex ID = 413 + kdeTZIndex ID = 414 + keaIndex ID = 415 + keaCVIndex ID = 416 + khqIndex ID = 417 + khqMLIndex ID = 418 + kiIndex ID = 419 + kiKEIndex ID = 420 + kkIndex ID = 421 + kkKZIndex ID = 422 + kkjIndex ID = 423 + kkjCMIndex ID = 424 + klIndex ID = 425 + klGLIndex ID = 426 + klnIndex ID = 427 + klnKEIndex ID = 428 + kmIndex ID = 429 + kmKHIndex ID = 430 + knIndex ID = 431 + knINIndex ID = 432 + koIndex ID = 433 + koKPIndex ID = 434 + koKRIndex ID = 435 + kokIndex ID = 436 + kokINIndex ID = 437 + ksIndex ID = 438 + ksINIndex ID = 439 + ksbIndex ID = 440 + ksbTZIndex ID = 441 + ksfIndex ID = 442 + ksfCMIndex ID = 443 + kshIndex ID = 444 + kshDEIndex ID = 445 + kuIndex ID = 446 + kwIndex ID = 447 + kwGBIndex ID = 448 + kyIndex ID = 449 + kyKGIndex ID = 450 + lagIndex ID = 451 + lagTZIndex ID = 452 + lbIndex ID = 453 + lbLUIndex ID = 454 + lgIndex ID = 455 + lgUGIndex ID = 456 + lktIndex ID = 457 + lktUSIndex ID = 458 + lnIndex ID = 459 + lnAOIndex ID = 460 + lnCDIndex ID = 461 + lnCFIndex ID = 462 + lnCGIndex ID = 463 + loIndex ID = 464 + loLAIndex ID = 465 + lrcIndex ID = 466 + lrcIQIndex ID = 467 + lrcIRIndex ID = 468 + ltIndex ID = 469 + ltLTIndex ID = 470 + luIndex ID = 471 + luCDIndex ID = 472 + luoIndex ID = 473 + luoKEIndex ID = 474 + luyIndex ID = 475 + luyKEIndex ID = 476 + lvIndex ID = 477 + lvLVIndex ID = 478 + masIndex ID = 479 + masKEIndex ID = 480 + masTZIndex ID = 481 + merIndex ID = 482 + merKEIndex ID = 483 + mfeIndex ID = 484 + mfeMUIndex ID = 485 + mgIndex ID = 486 + mgMGIndex ID = 487 + mghIndex ID = 488 + mghMZIndex ID = 489 + mgoIndex ID = 490 + mgoCMIndex ID = 491 + mkIndex ID = 492 + mkMKIndex ID = 493 + mlIndex ID = 494 + mlINIndex ID = 495 + mnIndex ID = 496 + mnMNIndex ID = 497 + moIndex ID = 498 + mrIndex ID = 499 + mrINIndex ID = 500 + msIndex ID = 501 + msBNIndex ID = 502 + msMYIndex ID = 503 + msSGIndex ID = 504 + mtIndex ID = 505 + mtMTIndex ID = 506 + muaIndex ID = 507 + muaCMIndex ID = 508 + myIndex ID = 509 + myMMIndex ID = 510 + mznIndex ID = 511 + mznIRIndex ID = 512 + nahIndex ID = 513 + naqIndex ID = 514 + naqNAIndex ID = 515 + nbIndex ID = 516 + nbNOIndex ID = 517 + nbSJIndex ID = 518 + ndIndex ID = 519 + ndZWIndex ID = 520 + ndsIndex ID = 521 + ndsDEIndex ID = 522 + ndsNLIndex ID = 523 + neIndex ID = 524 + neINIndex ID = 525 + neNPIndex ID = 526 + nlIndex ID = 527 + nlAWIndex ID = 528 + nlBEIndex ID = 529 + nlBQIndex ID = 530 + nlCWIndex ID = 531 + nlNLIndex ID = 532 + nlSRIndex ID = 533 + nlSXIndex ID = 534 + nmgIndex ID = 535 + nmgCMIndex ID = 536 + nnIndex ID = 537 + nnNOIndex ID = 538 + nnhIndex ID = 539 + nnhCMIndex ID = 540 + noIndex ID = 541 + nqoIndex ID = 542 + nrIndex ID = 543 + nsoIndex ID = 544 + nusIndex ID = 545 + nusSSIndex ID = 546 + nyIndex ID = 547 + nynIndex ID = 548 + nynUGIndex ID = 549 + omIndex ID = 550 + omETIndex ID = 551 + omKEIndex ID = 552 + orIndex ID = 553 + orINIndex ID = 554 + osIndex ID = 555 + osGEIndex ID = 556 + osRUIndex ID = 557 + paIndex ID = 558 + paArabIndex ID = 559 + paArabPKIndex ID = 560 + paGuruIndex ID = 561 + paGuruINIndex ID = 562 + papIndex ID = 563 + plIndex ID = 564 + plPLIndex ID = 565 + prgIndex ID = 566 + prg001Index ID = 567 + psIndex ID = 568 + psAFIndex ID = 569 + ptIndex ID = 570 + ptAOIndex ID = 571 + ptBRIndex ID = 572 + ptCHIndex ID = 573 + ptCVIndex ID = 574 + ptGQIndex ID = 575 + ptGWIndex ID = 576 + ptLUIndex ID = 577 + ptMOIndex ID = 578 + ptMZIndex ID = 579 + ptPTIndex ID = 580 + ptSTIndex ID = 581 + ptTLIndex ID = 582 + quIndex ID = 583 + quBOIndex ID = 584 + quECIndex ID = 585 + quPEIndex ID = 586 + rmIndex ID = 587 + rmCHIndex ID = 588 + rnIndex ID = 589 + rnBIIndex ID = 590 + roIndex ID = 591 + roMDIndex ID = 592 + roROIndex ID = 593 + rofIndex ID = 594 + rofTZIndex ID = 595 + ruIndex ID = 596 + ruBYIndex ID = 597 + ruKGIndex ID = 598 + ruKZIndex ID = 599 + ruMDIndex ID = 600 + ruRUIndex ID = 601 + ruUAIndex ID = 602 + rwIndex ID = 603 + rwRWIndex ID = 604 + rwkIndex ID = 605 + rwkTZIndex ID = 606 + sahIndex ID = 607 + sahRUIndex ID = 608 + saqIndex ID = 609 + saqKEIndex ID = 610 + sbpIndex ID = 611 + sbpTZIndex ID = 612 + sdIndex ID = 613 + sdPKIndex ID = 614 + sdhIndex ID = 615 + seIndex ID = 616 + seFIIndex ID = 617 + seNOIndex ID = 618 + seSEIndex ID = 619 + sehIndex ID = 620 + sehMZIndex ID = 621 + sesIndex ID = 622 + sesMLIndex ID = 623 + sgIndex ID = 624 + sgCFIndex ID = 625 + shIndex ID = 626 + shiIndex ID = 627 + shiLatnIndex ID = 628 + shiLatnMAIndex ID = 629 + shiTfngIndex ID = 630 + shiTfngMAIndex ID = 631 + siIndex ID = 632 + siLKIndex ID = 633 + skIndex ID = 634 + skSKIndex ID = 635 + slIndex ID = 636 + slSIIndex ID = 637 + smaIndex ID = 638 + smiIndex ID = 639 + smjIndex ID = 640 + smnIndex ID = 641 + smnFIIndex ID = 642 + smsIndex ID = 643 + snIndex ID = 644 + snZWIndex ID = 645 + soIndex ID = 646 + soDJIndex ID = 647 + soETIndex ID = 648 + soKEIndex ID = 649 + soSOIndex ID = 650 + sqIndex ID = 651 + sqALIndex ID = 652 + sqMKIndex ID = 653 + sqXKIndex ID = 654 + srIndex ID = 655 + srCyrlIndex ID = 656 + srCyrlBAIndex ID = 657 + srCyrlMEIndex ID = 658 + srCyrlRSIndex ID = 659 + srCyrlXKIndex ID = 660 + srLatnIndex ID = 661 + srLatnBAIndex ID = 662 + srLatnMEIndex ID = 663 + srLatnRSIndex ID = 664 + srLatnXKIndex ID = 665 + ssIndex ID = 666 + ssyIndex ID = 667 + stIndex ID = 668 + svIndex ID = 669 + svAXIndex ID = 670 + svFIIndex ID = 671 + svSEIndex ID = 672 + swIndex ID = 673 + swCDIndex ID = 674 + swKEIndex ID = 675 + swTZIndex ID = 676 + swUGIndex ID = 677 + syrIndex ID = 678 + taIndex ID = 679 + taINIndex ID = 680 + taLKIndex ID = 681 + taMYIndex ID = 682 + taSGIndex ID = 683 + teIndex ID = 684 + teINIndex ID = 685 + teoIndex ID = 686 + teoKEIndex ID = 687 + teoUGIndex ID = 688 + tgIndex ID = 689 + tgTJIndex ID = 690 + thIndex ID = 691 + thTHIndex ID = 692 + tiIndex ID = 693 + tiERIndex ID = 694 + tiETIndex ID = 695 + tigIndex ID = 696 + tkIndex ID = 697 + tkTMIndex ID = 698 + tlIndex ID = 699 + tnIndex ID = 700 + toIndex ID = 701 + toTOIndex ID = 702 + trIndex ID = 703 + trCYIndex ID = 704 + trTRIndex ID = 705 + tsIndex ID = 706 + ttIndex ID = 707 + ttRUIndex ID = 708 + twqIndex ID = 709 + twqNEIndex ID = 710 + tzmIndex ID = 711 + tzmMAIndex ID = 712 + ugIndex ID = 713 + ugCNIndex ID = 714 + ukIndex ID = 715 + ukUAIndex ID = 716 + urIndex ID = 717 + urINIndex ID = 718 + urPKIndex ID = 719 + uzIndex ID = 720 + uzArabIndex ID = 721 + uzArabAFIndex ID = 722 + uzCyrlIndex ID = 723 + uzCyrlUZIndex ID = 724 + uzLatnIndex ID = 725 + uzLatnUZIndex ID = 726 + vaiIndex ID = 727 + vaiLatnIndex ID = 728 + vaiLatnLRIndex ID = 729 + vaiVaiiIndex ID = 730 + vaiVaiiLRIndex ID = 731 + veIndex ID = 732 + viIndex ID = 733 + viVNIndex ID = 734 + voIndex ID = 735 + vo001Index ID = 736 + vunIndex ID = 737 + vunTZIndex ID = 738 + waIndex ID = 739 + waeIndex ID = 740 + waeCHIndex ID = 741 + woIndex ID = 742 + woSNIndex ID = 743 + xhIndex ID = 744 + xogIndex ID = 745 + xogUGIndex ID = 746 + yavIndex ID = 747 + yavCMIndex ID = 748 + yiIndex ID = 749 + yi001Index ID = 750 + yoIndex ID = 751 + yoBJIndex ID = 752 + yoNGIndex ID = 753 + yueIndex ID = 754 + yueHansIndex ID = 755 + yueHansCNIndex ID = 756 + yueHantIndex ID = 757 + yueHantHKIndex ID = 758 + zghIndex ID = 759 + zghMAIndex ID = 760 + zhIndex ID = 761 + zhHansIndex ID = 762 + zhHansCNIndex ID = 763 + zhHansHKIndex ID = 764 + zhHansMOIndex ID = 765 + zhHansSGIndex ID = 766 + zhHantIndex ID = 767 + zhHantHKIndex ID = 768 + zhHantMOIndex ID = 769 + zhHantTWIndex ID = 770 + zuIndex ID = 771 + zuZAIndex ID = 772 + caESvalenciaIndex ID = 773 + enUSuvaposixIndex ID = 774 +) + +var coreTags = []language.CompactCoreInfo{ // 773 elements + // Entry 0 - 1F + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, + // Entry 20 - 3F + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, + 0x05e00052, 0x07100000, 0x07100047, 0x07500000, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, + // Entry 40 - 5F + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, + // Entry 60 - 7F + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, + // Entry 80 - 9F + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, + 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, + 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, + 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, + 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, + // Entry A0 - BF + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, + // Entry C0 - DF + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, + // Entry E0 - FF + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, + 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, + 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, + // Entry 100 - 11F + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, + // Entry 120 - 13F + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, + 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, + 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, + 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, + // Entry 140 - 15F + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, + // Entry 160 - 17F + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, + // Entry 180 - 19F + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, + // Entry 1A0 - 1BF + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, + // Entry 1C0 - 1DF + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, + 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, + // Entry 1E0 - 1FF + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, + // Entry 200 - 21F + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, + 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, + // Entry 220 - 23F + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, + 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, + // Entry 240 - 25F + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, + 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, + // Entry 260 - 27F + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, + 0x40200000, 0x4020004c, 0x40700000, 0x40800000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, + // Entry 280 - 29F + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, + // Entry 2A0 - 2BF + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, + // Entry 2C0 - 2DF + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, + 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, + // Entry 2E0 - 2FF + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, + 0x50900052, 0x51200000, 0x51200001, 0x51800000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, + // Entry 300 - 31F + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, +} // Size: 3116 bytes + +const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" + +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go new file mode 100644 index 0000000..ca135d2 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tags.go @@ -0,0 +1,91 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package compact + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag{language: afIndex, locale: afIndex} + Amharic Tag = Tag{language: amIndex, locale: amIndex} + Arabic Tag = Tag{language: arIndex, locale: arIndex} + ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} + Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} + Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} + Bengali Tag = Tag{language: bnIndex, locale: bnIndex} + Catalan Tag = Tag{language: caIndex, locale: caIndex} + Czech Tag = Tag{language: csIndex, locale: csIndex} + Danish Tag = Tag{language: daIndex, locale: daIndex} + German Tag = Tag{language: deIndex, locale: deIndex} + Greek Tag = Tag{language: elIndex, locale: elIndex} + English Tag = Tag{language: enIndex, locale: enIndex} + AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} + BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} + Spanish Tag = Tag{language: esIndex, locale: esIndex} + EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} + LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} + Estonian Tag = Tag{language: etIndex, locale: etIndex} + Persian Tag = Tag{language: faIndex, locale: faIndex} + Finnish Tag = Tag{language: fiIndex, locale: fiIndex} + Filipino Tag = Tag{language: filIndex, locale: filIndex} + French Tag = Tag{language: frIndex, locale: frIndex} + CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} + Gujarati Tag = Tag{language: guIndex, locale: guIndex} + Hebrew Tag = Tag{language: heIndex, locale: heIndex} + Hindi Tag = Tag{language: hiIndex, locale: hiIndex} + Croatian Tag = Tag{language: hrIndex, locale: hrIndex} + Hungarian Tag = Tag{language: huIndex, locale: huIndex} + Armenian Tag = Tag{language: hyIndex, locale: hyIndex} + Indonesian Tag = Tag{language: idIndex, locale: idIndex} + Icelandic Tag = Tag{language: isIndex, locale: isIndex} + Italian Tag = Tag{language: itIndex, locale: itIndex} + Japanese Tag = Tag{language: jaIndex, locale: jaIndex} + Georgian Tag = Tag{language: kaIndex, locale: kaIndex} + Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} + Khmer Tag = Tag{language: kmIndex, locale: kmIndex} + Kannada Tag = Tag{language: knIndex, locale: knIndex} + Korean Tag = Tag{language: koIndex, locale: koIndex} + Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} + Lao Tag = Tag{language: loIndex, locale: loIndex} + Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} + Latvian Tag = Tag{language: lvIndex, locale: lvIndex} + Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} + Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} + Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} + Marathi Tag = Tag{language: mrIndex, locale: mrIndex} + Malay Tag = Tag{language: msIndex, locale: msIndex} + Burmese Tag = Tag{language: myIndex, locale: myIndex} + Nepali Tag = Tag{language: neIndex, locale: neIndex} + Dutch Tag = Tag{language: nlIndex, locale: nlIndex} + Norwegian Tag = Tag{language: noIndex, locale: noIndex} + Punjabi Tag = Tag{language: paIndex, locale: paIndex} + Polish Tag = Tag{language: plIndex, locale: plIndex} + Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} + BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} + EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} + Romanian Tag = Tag{language: roIndex, locale: roIndex} + Russian Tag = Tag{language: ruIndex, locale: ruIndex} + Sinhala Tag = Tag{language: siIndex, locale: siIndex} + Slovak Tag = Tag{language: skIndex, locale: skIndex} + Slovenian Tag = Tag{language: slIndex, locale: slIndex} + Albanian Tag = Tag{language: sqIndex, locale: sqIndex} + Serbian Tag = Tag{language: srIndex, locale: srIndex} + SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} + Swedish Tag = Tag{language: svIndex, locale: svIndex} + Swahili Tag = Tag{language: swIndex, locale: swIndex} + Tamil Tag = Tag{language: taIndex, locale: taIndex} + Telugu Tag = Tag{language: teIndex, locale: teIndex} + Thai Tag = Tag{language: thIndex, locale: thIndex} + Turkish Tag = Tag{language: trIndex, locale: trIndex} + Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} + Urdu Tag = Tag{language: urIndex, locale: urIndex} + Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} + Vietnamese Tag = Tag{language: viIndex, locale: viIndex} + Chinese Tag = Tag{language: zhIndex, locale: zhIndex} + SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} + TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} + Zulu Tag = Tag{language: zuIndex, locale: zuIndex} +) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go new file mode 100644 index 0000000..4ae78e0 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compose.go @@ -0,0 +1,167 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "sort" + "strings" +) + +// A Builder allows constructing a Tag from individual components. +// Its main user is Compose in the top-level language package. +type Builder struct { + Tag Tag + + private string // the x extension + variants []string + extensions []string +} + +// Make returns a new Tag from the current settings. +func (b *Builder) Make() Tag { + t := b.Tag + + if len(b.extensions) > 0 || len(b.variants) > 0 { + sort.Sort(sortVariants(b.variants)) + sort.Strings(b.extensions) + + if b.private != "" { + b.extensions = append(b.extensions, b.private) + } + n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) + buf := make([]byte, n) + p := t.genCoreBytes(buf) + t.pVariant = byte(p) + p += appendTokens(buf[p:], b.variants...) + t.pExt = uint16(p) + p += appendTokens(buf[p:], b.extensions...) + t.str = string(buf[:p]) + // We may not always need to remake the string, but when or when not + // to do so is rather tricky. + scan := makeScanner(buf[:p]) + t, _ = parse(&scan, "") + return t + + } else if b.private != "" { + t.str = b.private + t.RemakeString() + } + return t +} + +// SetTag copies all the settings from a given Tag. Any previously set values +// are discarded. +func (b *Builder) SetTag(t Tag) { + b.Tag.LangID = t.LangID + b.Tag.RegionID = t.RegionID + b.Tag.ScriptID = t.ScriptID + // TODO: optimize + b.variants = b.variants[:0] + if variants := t.Variants(); variants != "" { + for _, vr := range strings.Split(variants[1:], "-") { + b.variants = append(b.variants, vr) + } + } + b.extensions, b.private = b.extensions[:0], "" + for _, e := range t.Extensions() { + b.AddExt(e) + } +} + +// AddExt adds extension e to the tag. e must be a valid extension as returned +// by Tag.Extension. If the extension already exists, it will be discarded, +// except for a -u extension, where non-existing key-type pairs will added. +func (b *Builder) AddExt(e string) { + if e[0] == 'x' { + if b.private == "" { + b.private = e + } + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] += e[1:] + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// SetExt sets the extension e to the tag. e must be a valid extension as +// returned by Tag.Extension. If the extension already exists, it will be +// overwritten, except for a -u extension, where the individual key-type pairs +// will be set. +func (b *Builder) SetExt(e string) { + if e[0] == 'x' { + b.private = e + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] = e + s[1:] + } else { + b.extensions[i] = e + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// AddVariant adds any number of variants. +func (b *Builder) AddVariant(v ...string) { + for _, v := range v { + if v != "" { + b.variants = append(b.variants, v) + } + } +} + +// ClearVariants removes any variants previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearVariants() { + b.variants = b.variants[:0] +} + +// ClearExtensions removes any extensions previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearExtensions() { + b.private = "" + b.extensions = b.extensions[:0] +} + +func tokenLen(token ...string) (n int) { + for _, t := range token { + n += len(t) + 1 + } + return +} + +func appendTokens(b []byte, token ...string) int { + p := 0 + for _, t := range token { + b[p] = '-' + copy(b[p+1:], t) + p += 1 + len(t) + } + return p +} + +type sortVariants []string + +func (s sortVariants) Len() int { + return len(s) +} + +func (s sortVariants) Swap(i, j int) { + s[j], s[i] = s[i], s[j] +} + +func (s sortVariants) Less(i, j int) bool { + return variantIndex[s[i]] < variantIndex[s[j]] +} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go new file mode 100644 index 0000000..9b20b88 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/coverage.go @@ -0,0 +1,28 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func BaseLanguages() []Language { + base := make([]Language, 0, NumLanguages) + for i := 0; i < langNoIndexOffset; i++ { + // We included "und" already for the value 0. + if i != nonCanonicalUnd { + base = append(base, Language(i)) + } + } + i := langNoIndexOffset + for _, v := range langNoIndex { + for k := 0; k < 8; k++ { + if v&1 == 1 { + base = append(base, Language(i)) + } + v >>= 1 + i++ + } + } + return base +} diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go new file mode 100644 index 0000000..09d41c7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/language.go @@ -0,0 +1,627 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go -output tables.go + +package language // import "golang.org/x/text/internal/language" + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "errors" + "fmt" + "strings" +) + +const ( + // maxCoreSize is the maximum size of a BCP 47 tag without variants and + // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. + maxCoreSize = 12 + + // max99thPercentileSize is a somewhat arbitrary buffer size that presumably + // is large enough to hold at least 99% of the BCP 47 tags. + max99thPercentileSize = 32 + + // maxSimpleUExtensionSize is the maximum size of a -u extension with one + // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). + maxSimpleUExtensionSize = 14 +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. The zero value of Tag is Und. +type Tag struct { + // TODO: the following fields have the form TagTypeID. This name is chosen + // to allow refactoring the public package without conflicting with its + // Base, Script, and Region methods. Once the transition is fully completed + // the ID can be stripped from the name. + + LangID Language + RegionID Region + // TODO: we will soon run out of positions for ScriptID. Idea: instead of + // storing lang, region, and ScriptID codes, store only the compact index and + // have a lookup table from this code to its expansion. This greatly speeds + // up table lookup, speed up common variant cases. + // This will also immediately free up 3 extra bytes. Also, the pVariant + // field can now be moved to the lookup table, as the compact index uniquely + // determines the offset of a possible variant. + ScriptID Script + pVariant byte // offset in str, includes preceding '-' + pExt uint16 // offset of first extension, includes preceding '-' + + // str is the string representation of the Tag. It will only be used if the + // tag has variants or extensions. + str string +} + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + t, _ := Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +// TODO: consider removing +func (t Tag) Raw() (b Language, s Script, r Region) { + return t.LangID, t.ScriptID, t.RegionID +} + +// equalTags compares language, script and region subtags only. +func (t Tag) equalTags(a Tag) bool { + return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if int(t.pVariant) < len(t.str) { + return false + } + return t.equalTags(Und) +} + +// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use +// tag. +func (t Tag) IsPrivateUse() bool { + return t.str != "" && t.pVariant == 0 +} + +// RemakeString is used to update t.str in case lang, script or region changed. +// It is assumed that pExt and pVariant still point to the start of the +// respective parts. +func (t *Tag) RemakeString() { + if t.str == "" { + return + } + extra := t.str[t.pVariant:] + if t.pVariant > 0 { + extra = extra[1:] + } + if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { + t.str = extra + t.pVariant = 0 + t.pExt = 0 + return + } + var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. + b := buf[:t.genCoreBytes(buf[:])] + if extra != "" { + diff := len(b) - int(t.pVariant) + b = append(b, '-') + b = append(b, extra...) + t.pVariant = uint8(int(t.pVariant) + diff) + t.pExt = uint16(int(t.pExt) + diff) + } else { + t.pVariant = uint8(len(b)) + t.pExt = uint16(len(b)) + } + t.str = string(b) +} + +// genCoreBytes writes a string for the base languages, script and region tags +// to the given buffer and returns the number of bytes written. It will never +// write more than maxCoreSize bytes. +func (t *Tag) genCoreBytes(buf []byte) int { + n := t.LangID.StringToBuf(buf[:]) + if t.ScriptID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.ScriptID.String()) + } + if t.RegionID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.RegionID.String()) + } + return n +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + if t.str != "" { + return t.str + } + if t.ScriptID == 0 && t.RegionID == 0 { + return t.LangID.String() + } + buf := [maxCoreSize]byte{} + return string(buf[:t.genCoreBytes(buf[:])]) +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + if t.str != "" { + text = append(text, t.str...) + } else if t.ScriptID == 0 && t.RegionID == 0 { + text = append(text, t.LangID.String()...) + } else { + buf := [maxCoreSize]byte{} + text = buf[:t.genCoreBytes(buf[:])] + } + return text, nil +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + tag, err := Parse(string(text)) + *t = tag + return err +} + +// Variants returns the part of the tag holding all variants or the empty string +// if there are no variants defined. +func (t Tag) Variants() string { + if t.pVariant == 0 { + return "" + } + return t.str[t.pVariant:t.pExt] +} + +// VariantOrPrivateUseTags returns variants or private use tags. +func (t Tag) VariantOrPrivateUseTags() string { + if t.pExt > 0 { + return t.str[t.pVariant:t.pExt] + } + return t.str[t.pVariant:] +} + +// HasString reports whether this tag defines more than just the raw +// components. +func (t Tag) HasString() bool { + return t.str != "" +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.str != "" { + // Strip the variants and extensions. + b, s, r := t.Raw() + t = Tag{LangID: b, ScriptID: s, RegionID: r} + if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID == t.ScriptID { + return Tag{LangID: t.LangID} + } + } + return t + } + if t.LangID != 0 { + if t.RegionID != 0 { + maxScript := t.ScriptID + if maxScript == 0 { + max, _ := addTags(t) + maxScript = max.ScriptID + } + + for i := range parents { + if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { + for _, r := range parents[i].fromRegion { + if Region(r) == t.RegionID { + return Tag{ + LangID: t.LangID, + ScriptID: Script(parents[i].script), + RegionID: Region(parents[i].toRegion), + } + } + } + } + } + + // Strip the script if it is the default one. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != maxScript { + return Tag{LangID: t.LangID, ScriptID: maxScript} + } + return Tag{LangID: t.LangID} + } else if t.ScriptID != 0 { + // The parent for an base-script pair with a non-default script is + // "und" instead of the base language. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != t.ScriptID { + return Und + } + return Tag{LangID: t.LangID} + } + } + return Und +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (ext string, err error) { + defer func() { + if recover() != nil { + ext = "" + err = ErrSyntax + } + }() + + scan := makeScannerString(s) + var end int + if n := len(scan.token); n != 1 { + return "", ErrSyntax + } + scan.toLower(0, len(scan.b)) + end = parseExtension(&scan) + if end != len(s) { + return "", ErrSyntax + } + return string(scan.b), nil +} + +// HasVariants reports whether t has variants. +func (t Tag) HasVariants() bool { + return uint16(t.pVariant) < t.pExt +} + +// HasExtensions reports whether t has extensions. +func (t Tag) HasExtensions() bool { + return int(t.pExt) < len(t.str) +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext string, ok bool) { + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + if ext[0] == x { + return ext, true + } + } + return "", false +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []string { + e := []string{} + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + e = append(e, ext) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if _, start, end, _ := t.findTypeForKey(key); end != start { + s := t.str[start:end] + if p := strings.IndexByte(s, '-'); p >= 0 { + s = s[:p] + } + return s + } + return "" +} + +var ( + errPrivateUse = errors.New("cannot set a key on a private use tag") + errInvalidArguments = errors.New("invalid key or type") +) + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + if t.IsPrivateUse() { + return t, errPrivateUse + } + if len(key) != 2 { + return t, errInvalidArguments + } + + // Remove the setting if value is "". + if value == "" { + start, sep, end, _ := t.findTypeForKey(key) + if start != sep { + // Remove a possible empty extension. + switch { + case t.str[start-2] != '-': // has previous elements. + case end == len(t.str), // end of string + end+2 < len(t.str) && t.str[end+2] == '-': // end of extension + start -= 2 + } + if start == int(t.pVariant) && end == len(t.str) { + t.str = "" + t.pVariant, t.pExt = 0, 0 + } else { + t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) + } + } + return t, nil + } + + if len(value) < 3 || len(value) > 8 { + return t, errInvalidArguments + } + + var ( + buf [maxCoreSize + maxSimpleUExtensionSize]byte + uStart int // start of the -u extension. + ) + + // Generate the tag string if needed. + if t.str == "" { + uStart = t.genCoreBytes(buf[:]) + buf[uStart] = '-' + uStart++ + } + + // Create new key-type pair and parse it to verify. + b := buf[uStart:] + copy(b, "u-") + copy(b[2:], key) + b[4] = '-' + b = b[:5+copy(b[5:], value)] + scan := makeScanner(b) + if parseExtensions(&scan); scan.err != nil { + return t, scan.err + } + + // Assemble the replacement string. + if t.str == "" { + t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) + t.str = string(buf[:uStart+len(b)]) + } else { + s := t.str + start, sep, end, hasExt := t.findTypeForKey(key) + if start == sep { + if hasExt { + b = b[2:] + } + t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:]) + } else { + t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:]) + } + } + return t, nil +} + +// findTypeForKey returns the start and end position for the type corresponding +// to key or the point at which to insert the key-value pair if the type +// wasn't found. The hasExt return value reports whether an -u extension was present. +// Note: the extensions are typically very small and are likely to contain +// only one key-type pair. +func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) { + p := int(t.pExt) + if len(key) != 2 || p == len(t.str) || p == 0 { + return p, p, p, false + } + s := t.str + + // Find the correct extension. + for p++; s[p] != 'u'; p++ { + if s[p] > 'u' { + p-- + return p, p, p, false + } + if p = nextExtension(s, p); p == len(s) { + return len(s), len(s), len(s), false + } + } + // Proceed to the hyphen following the extension name. + p++ + + // curKey is the key currently being processed. + curKey := "" + + // Iterate over keys until we get the end of a section. + for { + end = p + for p++; p < len(s) && s[p] != '-'; p++ { + } + n := p - end - 1 + if n <= 2 && curKey == key { + if sep < end { + sep++ + } + return start, sep, end, true + } + switch n { + case 0, // invalid string + 1: // next extension + return end, end, end, true + case 2: + // next key + curKey = s[end+1 : p] + if curKey > key { + return end, end, end, true + } + start = end + sep = p + } + } +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (l Language, err error) { + defer func() { + if recover() != nil { + l = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getLangID(buf[:copy(buf[:], s)]) +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (scr Script, err error) { + defer func() { + if recover() != nil { + scr = 0 + err = ErrSyntax + } + }() + + if len(s) != 4 { + return 0, ErrSyntax + } + var buf [4]byte + return getScriptID(script, buf[:copy(buf[:], s)]) +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + return getRegionM49(r) +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (r Region, err error) { + defer func() { + if recover() != nil { + r = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getRegionID(buf[:copy(buf[:], s)]) +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { + return false + } + return true +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + if r == 0 { + return false + } + return int(regionInclusion[r]) < len(regionContainment) +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + if r == c { + return true + } + g := regionInclusion[r] + if g >= nRegionGroups { + return false + } + m := regionContainment[g] + + d := regionInclusion[c] + b := regionInclusionBits[d] + + // A contained country may belong to multiple disjoint groups. Matching any + // of these indicates containment. If the contained region is a group, it + // must strictly be a subset. + if d >= nRegionGroups { + return b&m != 0 + } + return b&^m == 0 +} + +var errNoTLD = errors.New("language: region is not a valid ccTLD") + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the + // difference between ISO 3166-1 and IANA ccTLD. + if r == _GB { + r = _UK + } + if (r.typ() & ccTLD) == 0 { + return 0, errNoTLD + } + return r, nil +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + if cr := normRegion(r); cr != 0 { + return cr + } + return r +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + ID uint8 + str string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (v Variant, err error) { + defer func() { + if recover() != nil { + v = Variant{} + err = ErrSyntax + } + }() + + s = strings.ToLower(s) + if id, ok := variantIndex[s]; ok { + return Variant{id, s}, nil + } + return Variant{}, NewValueError([]byte(s)) +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.str +} diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go new file mode 100644 index 0000000..231b4fb --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/lookup.go @@ -0,0 +1,412 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "fmt" + "sort" + "strconv" + + "golang.org/x/text/internal/tag" +) + +// findIndex tries to find the given tag in idx and returns a standardized error +// if it could not be found. +func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { + if !tag.FixCase(form, key) { + return 0, ErrSyntax + } + i := idx.Index(key) + if i == -1 { + return 0, NewValueError(key) + } + return i, nil +} + +func searchUint(imap []uint16, key uint16) int { + return sort.Search(len(imap), func(i int) bool { + return imap[i] >= key + }) +} + +type Language uint16 + +// getLangID returns the langID of s if s is a canonical subtag +// or langUnknown if s is not a canonical subtag. +func getLangID(s []byte) (Language, error) { + if len(s) == 2 { + return getLangISO2(s) + } + return getLangISO3(s) +} + +// TODO language normalization as well as the AliasMaps could be moved to the +// higher level package, but it is a bit tricky to separate the generation. + +func (id Language) Canonicalize() (Language, AliasType) { + return normLang(id) +} + +// normLang returns the mapped langID of id according to mapping m. +func normLang(id Language) (Language, AliasType) { + k := sort.Search(len(AliasMap), func(i int) bool { + return AliasMap[i].From >= uint16(id) + }) + if k < len(AliasMap) && AliasMap[k].From == uint16(id) { + return Language(AliasMap[k].To), AliasTypes[k] + } + return id, AliasTypeUnknown +} + +// getLangISO2 returns the langID for the given 2-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO2(s []byte) (Language, error) { + if !tag.FixCase("zz", s) { + return 0, ErrSyntax + } + if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { + return Language(i), nil + } + return 0, NewValueError(s) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s []byte) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +// getLangISO3 returns the langID for the given 3-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO3(s []byte) (Language, error) { + if tag.FixCase("und", s) { + // first try to match canonical 3-letter entries + for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { + if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { + // We treat "und" as special and always translate it to "unspecified". + // Note that ZZ and Zzzz are private use and are not treated as + // unspecified by default. + id := Language(i) + if id == nonCanonicalUnd { + return 0, nil + } + return id, nil + } + } + if i := altLangISO3.Index(s); i != -1 { + return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil + } + n := strToInt(s) + if langNoIndex[n/8]&(1<<(n%8)) != 0 { + return Language(n) + langNoIndexOffset, nil + } + // Check for non-canonical uses of ISO3. + for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { + if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Language(i), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +// StringToBuf writes the string to b and returns the number of bytes +// written. cap(b) must be >= 3. +func (id Language) StringToBuf(b []byte) int { + if id >= langNoIndexOffset { + intToStr(uint(id)-langNoIndexOffset, b[:3]) + return 3 + } else if id == 0 { + return copy(b, "und") + } + l := lang[id<<2:] + if l[3] == 0 { + return copy(b, l[:3]) + } + return copy(b, l[:2]) +} + +// String returns the BCP 47 representation of the langID. +// Use b as variable name, instead of id, to ensure the variable +// used is consistent with that of Base in which this type is embedded. +func (b Language) String() string { + if b == 0 { + return "und" + } else if b >= langNoIndexOffset { + b -= langNoIndexOffset + buf := [3]byte{} + intToStr(uint(b), buf[:]) + return string(buf[:]) + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } + return l[:2] +} + +// ISO3 returns the ISO 639-3 language code. +func (b Language) ISO3() string { + if b == 0 || b >= langNoIndexOffset { + return b.String() + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } else if l[2] == 0 { + return altLangISO3.Elem(int(l[3]))[:3] + } + // This allocation will only happen for 3-letter ISO codes + // that are non-canonical BCP 47 language identifiers. + return l[0:1] + l[2:4] +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Language) IsPrivateUse() bool { + return langPrivateStart <= b && b <= langPrivateEnd +} + +// SuppressScript returns the script marked as SuppressScript in the IANA +// language tag repository, or 0 if there is no such script. +func (b Language) SuppressScript() Script { + if b < langNoIndexOffset { + return Script(suppressScript[b]) + } + return 0 +} + +type Region uint16 + +// getRegionID returns the region id for s if s is a valid 2-letter region code +// or unknownRegion. +func getRegionID(s []byte) (Region, error) { + if len(s) == 3 { + if isAlpha(s[0]) { + return getRegionISO3(s) + } + if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { + return getRegionM49(int(i)) + } + } + return getRegionISO2(s) +} + +// getRegionISO2 returns the regionID for the given 2-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO2(s []byte) (Region, error) { + i, err := findIndex(regionISO, s, "ZZ") + if err != nil { + return 0, err + } + return Region(i) + isoRegionOffset, nil +} + +// getRegionISO3 returns the regionID for the given 3-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO3(s []byte) (Region, error) { + if tag.FixCase("ZZZ", s) { + for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { + if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Region(i) + isoRegionOffset, nil + } + } + for i := 0; i < len(altRegionISO3); i += 3 { + if tag.Compare(altRegionISO3[i:i+3], s) == 0 { + return Region(altRegionIDs[i/3]), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +func getRegionM49(n int) (Region, error) { + if 0 < n && n <= 999 { + const ( + searchBits = 7 + regionBits = 9 + regionMask = 1<> searchBits + buf := fromM49[m49Index[idx]:m49Index[idx+1]] + val := uint16(n) << regionBits // we rely on bits shifting out + i := sort.Search(len(buf), func(i int) bool { + return buf[i] >= val + }) + if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { + return Region(r & regionMask), nil + } + } + var e ValueError + fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) + return 0, e +} + +// normRegion returns a region if r is deprecated or 0 otherwise. +// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). +// TODO: consider mapping split up regions to new most populous one (like CLDR). +func normRegion(r Region) Region { + m := regionOldMap + k := sort.Search(len(m), func(i int) bool { + return m[i].From >= uint16(r) + }) + if k < len(m) && m[k].From == uint16(r) { + return Region(m[k].To) + } + return 0 +} + +const ( + iso3166UserAssigned = 1 << iota + ccTLD + bcp47Region +) + +func (r Region) typ() byte { + return regionTypes[r] +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + if r < isoRegionOffset { + if r == 0 { + return "ZZ" + } + return fmt.Sprintf("%03d", r.M49()) + } + r -= isoRegionOffset + return regionISO.Elem(int(r))[:2] +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + if r < isoRegionOffset { + return "ZZZ" + } + r -= isoRegionOffset + reg := regionISO.Elem(int(r)) + switch reg[2] { + case 0: + return altRegionISO3[reg[3]:][:3] + case ' ': + return "ZZZ" + } + return reg[0:1] + reg[2:4] +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return int(m49[r]) +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.typ()&iso3166UserAssigned != 0 +} + +type Script uint16 + +// getScriptID returns the script id for string s. It assumes that s +// is of the format [A-Z][a-z]{3}. +func getScriptID(idx tag.Index, s []byte) (Script, error) { + i, err := findIndex(idx, s, "Zzzz") + return Script(i), err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + if s == 0 { + return "Zzzz" + } + return script.Elem(int(s)) +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return _Qaaa <= s && s <= _Qabx +} + +const ( + maxAltTaglen = len("en-US-POSIX") + maxLen = maxAltTaglen +) + +var ( + // grandfatheredMap holds a mapping from legacy and grandfathered tags to + // their base language or index to more elaborate tag. + grandfatheredMap = map[[maxLen]byte]int16{ + [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban + [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami + [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn + [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak + [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon + [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux + [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo + [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn + [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao + [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay + [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu + [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok + [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL + [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE + [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu + [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan + [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang + + // Grandfathered tags with no modern replacement will be converted as + // follows: + [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish + [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed + [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default + [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian + [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min + + // CLDR-specific tag. + [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root + [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" + } + + altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} + + altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" +) + +func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { + if v, ok := grandfatheredMap[s]; ok { + if v < 0 { + return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true + } + t.LangID = Language(v) + return t, true + } + return t, false +} diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go new file mode 100644 index 0000000..75a2dbc --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/match.go @@ -0,0 +1,226 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "errors" + +type scriptRegionFlags uint8 + +const ( + isList = 1 << iota + scriptInFrom + regionInFrom +) + +func (t *Tag) setUndefinedLang(id Language) { + if t.LangID == 0 { + t.LangID = id + } +} + +func (t *Tag) setUndefinedScript(id Script) { + if t.ScriptID == 0 { + t.ScriptID = id + } +} + +func (t *Tag) setUndefinedRegion(id Region) { + if t.RegionID == 0 || t.RegionID.Contains(id) { + t.RegionID = id + } +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// addLikelySubtags sets subtags to their most likely value, given the locale. +// In most cases this means setting fields for unknown values, but in some +// cases it may alter a value. It returns an ErrMissingLikelyTagsData error +// if the given locale cannot be expanded. +func (t Tag) addLikelySubtags() (Tag, error) { + id, err := addTags(t) + if err != nil { + return t, err + } else if id.equalTags(t) { + return t, nil + } + id.RemakeString() + return id, nil +} + +// specializeRegion attempts to specialize a group region. +func specializeRegion(t *Tag) bool { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { + t.RegionID = Region(x.region) + } + return true + } + return false +} + +// Maximize returns a new tag with missing tags filled in. +func (t Tag) Maximize() (Tag, error) { + return addTags(t) +} + +func addTags(t Tag) (Tag, error) { + // We leave private use identifiers alone. + if t.IsPrivateUse() { + return t, nil + } + if t.ScriptID != 0 && t.RegionID != 0 { + if t.LangID != 0 { + // already fully specified + specializeRegion(&t) + return t, nil + } + // Search matches for und-script-region. Note that for these cases + // region will never be a group so there is no need to check for this. + list := likelyRegion[t.RegionID : t.RegionID+1] + if x := list[0]; x.flags&isList != 0 { + list = likelyRegionList[x.lang : x.lang+uint16(x.script)] + } + for _, x := range list { + // Deviating from the spec. See match_test.go for details. + if Script(x.script) == t.ScriptID { + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + } + if t.LangID != 0 { + // Search matches for lang-script and lang-region, where lang != und. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + list := likelyLangList[x.region : x.region+uint16(x.script)] + if t.ScriptID != 0 { + for _, x := range list { + if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { + t.setUndefinedRegion(Region(x.region)) + return t, nil + } + } + } else if t.RegionID != 0 { + count := 0 + goodScript := true + tt := t + for _, x := range list { + // We visit all entries for which the script was not + // defined, including the ones where the region was not + // defined. This allows for proper disambiguation within + // regions. + if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { + tt.RegionID = Region(x.region) + tt.setUndefinedScript(Script(x.script)) + goodScript = goodScript && tt.ScriptID == Script(x.script) + count++ + } + } + if count == 1 { + return tt, nil + } + // Even if we fail to find a unique Region, we might have + // an unambiguous script. + if goodScript { + t.ScriptID = tt.ScriptID + } + } + } + } + } else { + // Search matches for und-script. + if t.ScriptID != 0 { + x := likelyScript[t.ScriptID] + if x.region != 0 { + t.setUndefinedRegion(Region(x.region)) + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + // Search matches for und-region. If und-script-region exists, it would + // have been found earlier. + if t.RegionID != 0 { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if x.region != 0 { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + t.RegionID = Region(x.region) + } + } else { + x := likelyRegion[t.RegionID] + if x.flags&isList != 0 { + x = likelyRegionList[x.lang] + } + if x.script != 0 && x.flags != scriptInFrom { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + return t, nil + } + } + } + } + + // Search matches for lang. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + x = likelyLangList[x.region] + } + if x.region != 0 { + t.setUndefinedScript(Script(x.script)) + t.setUndefinedRegion(Region(x.region)) + } + specializeRegion(&t) + if t.LangID == 0 { + t.LangID = _en // default language + } + return t, nil + } + return t, ErrMissingLikelyTagsData +} + +func (t *Tag) setTagsFrom(id Tag) { + t.LangID = id.LangID + t.ScriptID = id.ScriptID + t.RegionID = id.RegionID +} + +// minimize removes the region or script subtags from t such that +// t.addLikelySubtags() == t.minimize().addLikelySubtags(). +func (t Tag) minimize() (Tag, error) { + t, err := minimizeTags(t) + if err != nil { + return t, err + } + t.RemakeString() + return t, nil +} + +// minimizeTags mimics the behavior of the ICU 51 C implementation. +func minimizeTags(t Tag) (Tag, error) { + if t.equalTags(Und) { + return t, nil + } + max, err := addTags(t) + if err != nil { + return t, err + } + for _, id := range [...]Tag{ + {LangID: t.LangID}, + {LangID: t.LangID, RegionID: t.RegionID}, + {LangID: t.LangID, ScriptID: t.ScriptID}, + } { + if x, err := addTags(id); err == nil && max.equalTags(x) { + t.setTagsFrom(id) + break + } + } + return t, nil +} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go new file mode 100644 index 0000000..aad1e0a --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/parse.go @@ -0,0 +1,608 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "errors" + "fmt" + "sort" + + "golang.org/x/text/internal/tag" +) + +// isAlpha returns true if the byte is not a digit. +// b must be an ASCII letter or digit. +func isAlpha(b byte) bool { + return b > '9' +} + +// isAlphaNum returns true if the string contains only ASCII letters or digits. +func isAlphaNum(s []byte) bool { + for _, c := range s { + if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { + return false + } + } + return true +} + +// ErrSyntax is returned by any of the parsing functions when the +// input is not well-formed, according to BCP 47. +// TODO: return the position at which the syntax error occurred? +var ErrSyntax = errors.New("language: tag is not well-formed") + +// ErrDuplicateKey is returned when a tag contains the same key twice with +// different values in the -u section. +var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError struct { + v [8]byte +} + +// NewValueError creates a new ValueError. +func NewValueError(tag []byte) ValueError { + var e ValueError + copy(e.v[:], tag) + return e +} + +func (e ValueError) tag() []byte { + n := bytes.IndexByte(e.v[:], 0) + if n == -1 { + n = 8 + } + return e.v[:n] +} + +// Error implements the error interface. +func (e ValueError) Error() string { + return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) +} + +// Subtag returns the subtag for which the error occurred. +func (e ValueError) Subtag() string { + return string(e.tag()) +} + +// scanner is used to scan BCP 47 tokens, which are separated by _ or -. +type scanner struct { + b []byte + bytes [max99thPercentileSize]byte + token []byte + start int // start position of the current token + end int // end position of the current token + next int // next point for scan + err error + done bool +} + +func makeScannerString(s string) scanner { + scan := scanner{} + if len(s) <= len(scan.bytes) { + scan.b = scan.bytes[:copy(scan.bytes[:], s)] + } else { + scan.b = []byte(s) + } + scan.init() + return scan +} + +// makeScanner returns a scanner using b as the input buffer. +// b is not copied and may be modified by the scanner routines. +func makeScanner(b []byte) scanner { + scan := scanner{b: b} + scan.init() + return scan +} + +func (s *scanner) init() { + for i, c := range s.b { + if c == '_' { + s.b[i] = '-' + } + } + s.scan() +} + +// restToLower converts the string between start and end to lower case. +func (s *scanner) toLower(start, end int) { + for i := start; i < end; i++ { + c := s.b[i] + if 'A' <= c && c <= 'Z' { + s.b[i] += 'a' - 'A' + } + } +} + +func (s *scanner) setError(e error) { + if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { + s.err = e + } +} + +// resizeRange shrinks or grows the array at position oldStart such that +// a new string of size newSize can fit between oldStart and oldEnd. +// Sets the scan point to after the resized range. +func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { + s.start = oldStart + if end := oldStart + newSize; end != oldEnd { + diff := end - oldEnd + var b []byte + if n := len(s.b) + diff; n > cap(s.b) { + b = make([]byte, n) + copy(b, s.b[:oldStart]) + } else { + b = s.b[:n] + } + copy(b[end:], s.b[oldEnd:]) + s.b = b + s.next = end + (s.next - s.end) + s.end = end + } +} + +// replace replaces the current token with repl. +func (s *scanner) replace(repl string) { + s.resizeRange(s.start, s.end, len(repl)) + copy(s.b[s.start:], repl) +} + +// gobble removes the current token from the input. +// Caller must call scan after calling gobble. +func (s *scanner) gobble(e error) { + s.setError(e) + if s.start == 0 { + s.b = s.b[:+copy(s.b, s.b[s.next:])] + s.end = 0 + } else { + s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] + s.end = s.start - 1 + } + s.next = s.start +} + +// deleteRange removes the given range from s.b before the current token. +func (s *scanner) deleteRange(start, end int) { + s.b = s.b[:start+copy(s.b[start:], s.b[end:])] + diff := end - start + s.next -= diff + s.start -= diff + s.end -= diff +} + +// scan parses the next token of a BCP 47 string. Tokens that are larger +// than 8 characters or include non-alphanumeric characters result in an error +// and are gobbled and removed from the output. +// It returns the end position of the last token consumed. +func (s *scanner) scan() (end int) { + end = s.end + s.token = nil + for s.start = s.next; s.next < len(s.b); { + i := bytes.IndexByte(s.b[s.next:], '-') + if i == -1 { + s.end = len(s.b) + s.next = len(s.b) + i = s.end - s.start + } else { + s.end = s.next + i + s.next = s.end + 1 + } + token := s.b[s.start:s.end] + if i < 1 || i > 8 || !isAlphaNum(token) { + s.gobble(ErrSyntax) + continue + } + s.token = token + return end + } + if n := len(s.b); n > 0 && s.b[n-1] == '-' { + s.setError(ErrSyntax) + s.b = s.b[:len(s.b)-1] + } + s.done = true + return end +} + +// acceptMinSize parses multiple tokens of the given size or greater. +// It returns the end position of the last token consumed. +func (s *scanner) acceptMinSize(min int) (end int) { + end = s.end + s.scan() + for ; len(s.token) >= min; s.scan() { + end = s.end + } + return end +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +func Parse(s string) (t Tag, err error) { + // TODO: consider supporting old-style locale key-value pairs. + if s == "" { + return Und, ErrSyntax + } + defer func() { + if recover() != nil { + t = Und + err = ErrSyntax + return + } + }() + if len(s) <= maxAltTaglen { + b := [maxAltTaglen]byte{} + for i, c := range s { + // Generating invalid UTF-8 is okay as it won't match. + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } else if c == '_' { + c = '-' + } + b[i] = byte(c) + } + if t, ok := grandfathered(b); ok { + return t, nil + } + } + scan := makeScannerString(s) + return parse(&scan, s) +} + +func parse(scan *scanner, s string) (t Tag, err error) { + t = Und + var end int + if n := len(scan.token); n <= 1 { + scan.toLower(0, len(scan.b)) + if n == 0 || scan.token[0] != 'x' { + return t, ErrSyntax + } + end = parseExtensions(scan) + } else if n >= 4 { + return Und, ErrSyntax + } else { // the usual case + t, end = parseTag(scan, true) + if n := len(scan.token); n == 1 { + t.pExt = uint16(end) + end = parseExtensions(scan) + } else if end < len(scan.b) { + scan.setError(ErrSyntax) + scan.b = scan.b[:end] + } + } + if int(t.pVariant) < len(scan.b) { + if end < len(s) { + s = s[:end] + } + if len(s) > 0 && tag.Compare(s, scan.b) == 0 { + t.str = s + } else { + t.str = string(scan.b) + } + } else { + t.pVariant, t.pExt = 0, 0 + } + return t, scan.err +} + +// parseTag parses language, script, region and variants. +// It returns a Tag and the end position in the input that was parsed. +// If doNorm is true, then - will be normalized to . +func parseTag(scan *scanner, doNorm bool) (t Tag, end int) { + var e error + // TODO: set an error if an unknown lang, script or region is encountered. + t.LangID, e = getLangID(scan.token) + scan.setError(e) + scan.replace(t.LangID.String()) + langStart := scan.start + end = scan.scan() + for len(scan.token) == 3 && isAlpha(scan.token[0]) { + // From http://tools.ietf.org/html/bcp47, - tags are equivalent + // to a tag of the form . + if doNorm { + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + langStr := lang.String() + copy(scan.b[langStart:], langStr) + scan.b[langStart+len(langStr)] = '-' + scan.start = langStart + len(langStr) + 1 + } + scan.gobble(e) + } + end = scan.scan() + } + if len(scan.token) == 4 && isAlpha(scan.token[0]) { + t.ScriptID, e = getScriptID(script, scan.token) + if t.ScriptID == 0 { + scan.gobble(e) + } + end = scan.scan() + } + if n := len(scan.token); n >= 2 && n <= 3 { + t.RegionID, e = getRegionID(scan.token) + if t.RegionID == 0 { + scan.gobble(e) + } else { + scan.replace(t.RegionID.String()) + } + end = scan.scan() + } + scan.toLower(scan.start, len(scan.b)) + t.pVariant = byte(end) + end = parseVariants(scan, end, t) + t.pExt = uint16(end) + return t, end +} + +var separator = []byte{'-'} + +// parseVariants scans tokens as long as each token is a valid variant string. +// Duplicate variants are removed. +func parseVariants(scan *scanner, end int, t Tag) int { + start := scan.start + varIDBuf := [4]uint8{} + variantBuf := [4][]byte{} + varID := varIDBuf[:0] + variant := variantBuf[:0] + last := -1 + needSort := false + for ; len(scan.token) >= 4; scan.scan() { + // TODO: measure the impact of needing this conversion and redesign + // the data structure if there is an issue. + v, ok := variantIndex[string(scan.token)] + if !ok { + // unknown variant + // TODO: allow user-defined variants? + scan.gobble(NewValueError(scan.token)) + continue + } + varID = append(varID, v) + variant = append(variant, scan.token) + if !needSort { + if last < int(v) { + last = int(v) + } else { + needSort = true + // There is no legal combinations of more than 7 variants + // (and this is by no means a useful sequence). + const maxVariants = 8 + if len(varID) > maxVariants { + break + } + } + } + end = scan.end + } + if needSort { + sort.Sort(variantsSort{varID, variant}) + k, l := 0, -1 + for i, v := range varID { + w := int(v) + if l == w { + // Remove duplicates. + continue + } + varID[k] = varID[i] + variant[k] = variant[i] + k++ + l = w + } + if str := bytes.Join(variant[:k], separator); len(str) == 0 { + end = start - 1 + } else { + scan.resizeRange(start, end, len(str)) + copy(scan.b[scan.start:], str) + end = scan.end + } + } + return end +} + +type variantsSort struct { + i []uint8 + v [][]byte +} + +func (s variantsSort) Len() int { + return len(s.i) +} + +func (s variantsSort) Swap(i, j int) { + s.i[i], s.i[j] = s.i[j], s.i[i] + s.v[i], s.v[j] = s.v[j], s.v[i] +} + +func (s variantsSort) Less(i, j int) bool { + return s.i[i] < s.i[j] +} + +type bytesSort struct { + b [][]byte + n int // first n bytes to compare +} + +func (b bytesSort) Len() int { + return len(b.b) +} + +func (b bytesSort) Swap(i, j int) { + b.b[i], b.b[j] = b.b[j], b.b[i] +} + +func (b bytesSort) Less(i, j int) bool { + for k := 0; k < b.n; k++ { + if b.b[i][k] == b.b[j][k] { + continue + } + return b.b[i][k] < b.b[j][k] + } + return false +} + +// parseExtensions parses and normalizes the extensions in the buffer. +// It returns the last position of scan.b that is part of any extension. +// It also trims scan.b to remove excess parts accordingly. +func parseExtensions(scan *scanner) int { + start := scan.start + exts := [][]byte{} + private := []byte{} + end := scan.end + for len(scan.token) == 1 { + extStart := scan.start + ext := scan.token[0] + end = parseExtension(scan) + extension := scan.b[extStart:end] + if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { + scan.setError(ErrSyntax) + end = extStart + continue + } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { + scan.b = scan.b[:end] + return end + } else if ext == 'x' { + private = extension + break + } + exts = append(exts, extension) + } + sort.Sort(bytesSort{exts, 1}) + if len(private) > 0 { + exts = append(exts, private) + } + scan.b = scan.b[:start] + if len(exts) > 0 { + scan.b = append(scan.b, bytes.Join(exts, separator)...) + } else if start > 0 { + // Strip trailing '-'. + scan.b = scan.b[:start-1] + } + return end +} + +// parseExtension parses a single extension and returns the position of +// the extension end. +func parseExtension(scan *scanner) int { + start, end := scan.start, scan.end + switch scan.token[0] { + case 'u': // https://www.ietf.org/rfc/rfc6067.txt + attrStart := end + scan.scan() + for last := []byte{}; len(scan.token) > 2; scan.scan() { + if bytes.Compare(scan.token, last) != -1 { + // Attributes are unsorted. Start over from scratch. + p := attrStart + 1 + scan.next = p + attrs := [][]byte{} + for scan.scan(); len(scan.token) > 2; scan.scan() { + attrs = append(attrs, scan.token) + end = scan.end + } + sort.Sort(bytesSort{attrs, 3}) + copy(scan.b[p:], bytes.Join(attrs, separator)) + break + } + last = scan.token + end = scan.end + } + // Scan key-type sequences. A key is of length 2 and may be followed + // by 0 or more "type" subtags from 3 to the maximum of 8 letters. + var last, key []byte + for attrEnd := end; len(scan.token) == 2; last = key { + key = scan.token + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + // TODO: check key value validity + if bytes.Compare(key, last) != 1 || scan.err != nil { + // We have an invalid key or the keys are not sorted. + // Start scanning keys from scratch and reorder. + p := attrEnd + 1 + scan.next = p + keys := [][]byte{} + for scan.scan(); len(scan.token) == 2; { + keyStart := scan.start + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + keys = append(keys, scan.b[keyStart:end]) + } + sort.Stable(bytesSort{keys, 2}) + if n := len(keys); n > 0 { + k := 0 + for i := 1; i < n; i++ { + if !bytes.Equal(keys[k][:2], keys[i][:2]) { + k++ + keys[k] = keys[i] + } else if !bytes.Equal(keys[k], keys[i]) { + scan.setError(ErrDuplicateKey) + } + } + keys = keys[:k+1] + } + reordered := bytes.Join(keys, separator) + if e := p + len(reordered); e < end { + scan.deleteRange(e, end) + end = e + } + copy(scan.b[p:], reordered) + break + } + } + case 't': // https://www.ietf.org/rfc/rfc6497.txt + scan.scan() + if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { + _, end = parseTag(scan, false) + scan.toLower(start, end) + } + for len(scan.token) == 2 && !isAlpha(scan.token[1]) { + end = scan.acceptMinSize(3) + } + case 'x': + end = scan.acceptMinSize(1) + default: + end = scan.acceptMinSize(2) + } + return end +} + +// getExtension returns the name, body and end position of the extension. +func getExtension(s string, p int) (end int, ext string) { + if s[p] == '-' { + p++ + } + if s[p] == 'x' { + return len(s), s[p:] + } + end = nextExtension(s, p) + return end, s[p:end] +} + +// nextExtension finds the next extension within the string, searching +// for the -- pattern from position p. +// In the fast majority of cases, language tags will have at most +// one extension and extensions tend to be small. +func nextExtension(s string, p int) int { + for n := len(s) - 3; p < n; { + if s[p] == '-' { + if s[p+2] == '-' { + return p + } + p += 3 + } else { + p++ + } + } + return len(s) +} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go new file mode 100644 index 0000000..14167e7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -0,0 +1,3494 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const NumLanguages = 8798 + +const NumScripts = 261 + +const NumRegions = 358 + +type FromTo struct { + From uint16 + To uint16 +} + +const nonCanonicalUnd = 1201 +const ( + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 250 + _da = 257 + _de = 269 + _el = 310 + _en = 313 + _es = 318 + _et = 320 + _fa = 328 + _fi = 337 + _fil = 339 + _fr = 350 + _gu = 420 + _he = 444 + _hi = 446 + _hr = 465 + _hu = 469 + _hy = 471 + _id = 481 + _is = 504 + _it = 505 + _ja = 512 + _ka = 528 + _kk = 578 + _km = 586 + _kn = 593 + _ko = 596 + _ky = 650 + _lo = 696 + _lt = 704 + _lv = 711 + _mk = 767 + _ml = 772 + _mn = 779 + _mo = 784 + _mr = 795 + _ms = 799 + _mul = 806 + _my = 817 + _nb = 839 + _ne = 849 + _nl = 871 + _no = 879 + _pa = 925 + _pl = 947 + _pt = 960 + _ro = 988 + _ru = 994 + _sh = 1031 + _si = 1036 + _sk = 1042 + _sl = 1046 + _sq = 1073 + _sr = 1074 + _sv = 1092 + _sw = 1093 + _ta = 1104 + _te = 1121 + _th = 1131 + _tl = 1146 + _tn = 1152 + _tr = 1162 + _uk = 1198 + _ur = 1204 + _uz = 1212 + _vi = 1219 + _zh = 1321 + _zu = 1327 + _jbo = 515 + _ami = 1650 + _bnn = 2357 + _hak = 438 + _tlh = 14467 + _lb = 661 + _nv = 899 + _pwn = 12055 + _tao = 14188 + _tay = 14198 + _tsu = 14662 + _nn = 874 + _sfb = 13629 + _vgt = 15701 + _sgg = 13660 + _cmn = 3007 + _nan = 835 + _hsn = 467 +) + +const langPrivateStart = 0x2f72 + +const langPrivateEnd = 0x3179 + +// lang holds an alphabetically sorted list of ISO-639 language identifiers. +// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +// For 2-byte language identifiers, the two successive bytes have the following meaning: +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// +// For 3-byte language identifiers the 4th byte is 0. +const lang tag.Index = "" + // Size: 5324 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + + "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + + "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + + "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + + "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + + "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + + "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + + "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + + "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + + "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + + "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + + "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + + "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + + "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + + "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + + "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + + "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + + "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + + "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + + "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + + "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + + "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + + "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + + "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + + "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + + "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + + "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + + "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + + "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + + "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + + "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + + "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + + "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + + "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + + "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + + "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + + "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + + "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + + "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + + "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + + "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + + "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + + "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + + "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + + "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + + "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + + "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + + "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + + "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + + "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + + "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + + "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + + "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + + "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + + "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + + "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + + "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + + "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + + "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + + "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + + "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + + "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + + "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + + "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + + "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + + "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + + "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + + "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + + "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + + "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + + "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + + "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + + "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + + "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + + "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + + "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + + "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + + "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + + "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + + "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + + "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + + "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + + "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + + "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + + "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + + "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + + "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + + "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + + "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + + "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + + "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + + "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + + "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + + "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + + "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + + "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + + "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + + "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + + "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + + "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + + "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + + "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" + +const langNoIndexOffset = 1330 + +// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +// in lookup tables. The language ids for these language codes are derived directly +// from the letters and are not consecutive. +// Size: 2197 bytes, 2197 elements +var langNoIndex = [2197]uint8{ + // Entry 0 - 3F + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, + // Entry 40 - 7F + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, + // Entry 80 - BF + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, + 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, + 0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + // Entry C0 - FF + 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, + 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, + 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, + 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, + // Entry 100 - 13F + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c, + 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, + 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, + // Entry 140 - 17F + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, + 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, + 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, + 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, + // Entry 180 - 1BF + 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, + 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, + // Entry 200 - 23F + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, + 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, + // Entry 240 - 27F + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66, + // Entry 280 - 2BF + 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, + 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + // Entry 2C0 - 2FF + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, + 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, + // Entry 300 - 33F + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0, + 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, + 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, + // Entry 340 - 37F + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, + // Entry 380 - 3BF + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, + // Entry 3C0 - 3FF + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, + 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, + 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, + // Entry 400 - 43F + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, + // Entry 440 - 47F + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, + // Entry 480 - 4BF + 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, + 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + // Entry 4C0 - 4FF + 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7, + 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, + 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, + // Entry 500 - 53F + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, + 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, + // Entry 540 - 57F + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + // Entry 580 - 5BF + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, + 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, + 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, + 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, + // Entry 5C0 - 5FF + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, + 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe, + // Entry 600 - 63F + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, + // Entry 640 - 67F + 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, + // Entry 680 - 6BF + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, + 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, + 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, + 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, + // Entry 6C0 - 6FF + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, + 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, + 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, + // Entry 700 - 73F + 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, + 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, + 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 740 - 77F + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, + 0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, + // Entry 780 - 7BF + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, + 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, + // Entry 7C0 - 7FF + 0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42, + 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, + 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, + // Entry 800 - 83F + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, + 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, + // Entry 840 - 87F + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, + 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, + 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, + 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, + // Entry 880 - 8BF + 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, + 0x0a, 0x00, 0x80, 0x00, 0x00, +} + +// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +// to 2-letter language codes that cannot be derived using the method described above. +// Each 3-letter code is followed by its 1-byte langID. +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" + +// altLangIndex is used to convert indexes in altLangISO3 to langIDs. +// Size: 12 bytes, 6 elements +var altLangIndex = [6]uint16{ + 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, +} + +// AliasMap maps langIDs to their suggested replacements. +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ + 0: {From: 0x82, To: 0x88}, + 1: {From: 0x187, To: 0x1ae}, + 2: {From: 0x1f3, To: 0x1e1}, + 3: {From: 0x1fb, To: 0x1bc}, + 4: {From: 0x208, To: 0x512}, + 5: {From: 0x20f, To: 0x20e}, + 6: {From: 0x310, To: 0x3dc}, + 7: {From: 0x347, To: 0x36f}, + 8: {From: 0x407, To: 0x432}, + 9: {From: 0x47a, To: 0x153}, + 10: {From: 0x490, To: 0x451}, + 11: {From: 0x4a2, To: 0x21}, + 12: {From: 0x53e, To: 0x544}, + 13: {From: 0x58f, To: 0x12d}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, +} + +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ + // Entry 0 - 3F + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, + // Entry 40 - 7F + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry 80 - BF + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, +} + +const ( + _Latn = 91 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 +) + +// script is an alphabetically sorted list of ISO 15924 codes. The index +// of the script in the string, divided by 4, is the internal scriptID. +const script tag.Index = "" + // Size: 1052 bytes + "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + +// suppressScript is an index from langID to the dominant script for that language, +// if it exists. If a script is given, it should be suppressed from the language tag. +// Size: 1330 bytes, 1330 elements +var suppressScript = [1330]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, + // Entry 140 - 17F + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, + // Entry 3C0 - 3FF + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + // Entry 480 - 4BF + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 4C0 - 4FF + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, +} + +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 +) + +// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +// the UN.M49 codes used for groups.) +const isoRegionOffset = 32 + +// regionTypes defines the status of a region for various standards. +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 80 - BF + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + // Entry 100 - 13F + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + // Entry 140 - 17F + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, +} + +// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +// Each 2-letter codes is followed by two bytes with the following meaning: +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1312 bytes + "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + +// altRegionISO3 holds a list of 3-letter region codes that cannot be +// mapped to 2-letter codes using the default algorithm. This is a short list. +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" + +// altRegionIDs holds a list of regionIDs the positions of which match those +// of the 3-letter ISO codes in altRegionISO3. +// Size: 22 bytes, 11 elements +var altRegionIDs = [11]uint16{ + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, +} + +// Size: 80 bytes, 20 elements +var regionOldMap = [20]FromTo{ + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, +} + +// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +// codes indicating collections of regions. +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ + // Entry 0 - 3F + 0, 1, 2, 3, 5, 9, 11, 13, + 14, 15, 17, 18, 19, 21, 29, 30, + 34, 35, 39, 53, 54, 57, 61, 142, + 143, 145, 150, 151, 154, 155, 202, 419, + 958, 0, 20, 784, 4, 28, 660, 8, + 51, 530, 24, 10, 32, 16, 40, 36, + 533, 248, 31, 70, 52, 50, 56, 854, + 100, 48, 108, 204, 652, 60, 96, 68, + // Entry 40 - 7F + 535, 76, 44, 64, 104, 74, 72, 112, + 84, 124, 166, 180, 140, 178, 756, 384, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, + // Entry 80 - BF + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, + // Entry C0 - FF + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, + // Entry 100 - 13F + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, + // Entry 140 - 17F + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, +} + +// m49Index gives indexes into fromM49 based on the three most significant bits +// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in +// +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// +// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +// The region code is stored in the 9 lsb of the indexed value. +// Size: 18 bytes, 9 elements +var m49Index = [9]int16{ + 0, 59, 108, 143, 181, 220, 259, 291, + 333, +} + +// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. +// Size: 666 bytes, 333 elements +var fromM49 = [333]uint16{ + // Entry 0 - 3F + 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, + 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, + 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, + 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, + // Entry 40 - 7F + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, + // Entry 80 - BF + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, + // Entry C0 - FF + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, + // Entry 100 - 13F + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, + // Entry 140 - 17F + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, +} + +// Size: 2128 bytes +var variantIndex = map[string]uint8{ + "1606nict": 0x0, + "1694acad": 0x1, + "1901": 0x2, + "1959acad": 0x3, + "1994": 0x67, + "1996": 0x4, + "abl1943": 0x5, + "akuapem": 0x6, + "alalc97": 0x69, + "aluku": 0x7, + "ao1990": 0x8, + "aranes": 0x9, + "arevela": 0xa, + "arevmda": 0xb, + "arkaika": 0xc, + "asante": 0xd, + "auvern": 0xe, + "baku1926": 0xf, + "balanka": 0x10, + "barla": 0x11, + "basiceng": 0x12, + "bauddha": 0x13, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, +} + +// variantNumSpecialized is the number of specialized variants in variants. +const variantNumSpecialized = 105 + +// nRegionGroups is the number of region groups. +const nRegionGroups = 33 + +type likelyLangRegion struct { + lang uint16 + region uint16 +} + +// likelyScript is a lookup table, indexed by scriptID, for the most likely +// languages and regions given a script. +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, + 8: {lang: 0x1d7, region: 0x28}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, + 11: {lang: 0x60, region: 0x52}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, + 14: {lang: 0xa5, region: 0x35}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, + 22: {lang: 0xdb, region: 0x35}, + 23: {lang: 0xf3, region: 0x49}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, + 42: {lang: 0x431, region: 0x27}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, + 47: {lang: 0xfe, region: 0x38}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, + 57: {lang: 0x529, region: 0x53}, + 58: {lang: 0x1cb, region: 0xe8}, + 59: {lang: 0x529, region: 0x53}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, +} + +type likelyScriptRegion struct { + region uint16 + script uint16 + flags uint8 +} + +// likelyLang is a lookup table, indexed by langID, for the most likely +// scripts and regions given incomplete information. If more entries exist for a +// given language, region and script are the index and size respectively +// of the list in likelyLangList. +// Size: 7980 bytes, 1330 elements +var likelyLang = [1330]likelyScriptRegion{ + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, + 96: {region: 0x52, script: 0xb, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, + 113: {region: 0x47, script: 0x20, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, + 126: {region: 0x38, script: 0x20, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, + 165: {region: 0x35, script: 0xe, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, + 219: {region: 0x35, script: 0x16, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, + 243: {region: 0x49, script: 0x17, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, + 245: {region: 0x49, script: 0x17, flags: 0x0}, + 246: {region: 0x49, script: 0x17, flags: 0x0}, + 247: {region: 0x49, script: 0x17, flags: 0x0}, + 248: {region: 0x49, script: 0x17, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, + 252: {region: 0x49, script: 0x17, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, + 254: {region: 0x8, script: 0x2, flags: 0x1}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, + 313: {region: 0xa, script: 0x2, flags: 0x1}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, + 334: {region: 0xc, script: 0x2, flags: 0x1}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, + 355: {region: 0x52, script: 0x5, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, + 373: {region: 0x53, script: 0x3b, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, + 416: {region: 0xe, script: 0x2, flags: 0x1}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, + 436: {region: 0x10, script: 0x3, flags: 0x1}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, + 438: {region: 0x53, script: 0x3b, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, + 441: {region: 0x24, script: 0x5, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, + 467: {region: 0x53, script: 0x3b, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, + 471: {region: 0x28, script: 0x8, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, + 506: {region: 0x49, script: 0x17, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, + 578: {region: 0x13, script: 0x6, flags: 0x1}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, + 628: {region: 0x19, script: 0x3, flags: 0x1}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, + 650: {region: 0x1c, script: 0x5, flags: 0x1}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, + 680: {region: 0x21, script: 0x2, flags: 0x1}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, + 713: {region: 0x53, script: 0x3b, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, + 720: {region: 0x23, script: 0x3, flags: 0x1}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, + 779: {region: 0x26, script: 0x3, flags: 0x1}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, + 799: {region: 0x29, script: 0x3, flags: 0x1}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, + 835: {region: 0x53, script: 0x3b, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, + 888: {region: 0x49, script: 0x17, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, + 925: {region: 0x2c, script: 0x3, flags: 0x1}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, + 927: {region: 0x2f, script: 0x2, flags: 0x1}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, + 958: {region: 0x24, script: 0x5, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, + 977: {region: 0x31, script: 0x2, flags: 0x1}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, + 979: {region: 0x35, script: 0xe, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, + 1018: {region: 0x33, script: 0x4, flags: 0x1}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, + 1074: {region: 0x37, script: 0x5, flags: 0x1}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, + 1101: {region: 0x35, script: 0xe, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, + 1127: {region: 0x3c, script: 0x3, flags: 0x1}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, + 1196: {region: 0x3f, script: 0x4, flags: 0x1}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, + 1202: {region: 0x43, script: 0x3, flags: 0x1}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, + 1212: {region: 0x46, script: 0x4, flags: 0x1}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, + 1259: {region: 0x53, script: 0x3b, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, + 1298: {region: 0x1, script: 0x3e, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1311: {region: 0x4a, script: 0x3, flags: 0x1}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1321: {region: 0x4d, script: 0x14, flags: 0x1}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, +} + +// likelyLangList holds lists info associated with likelyLang. +// Size: 582 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, + 9: {region: 0x38, script: 0x2f, flags: 0x2}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, + 17: {region: 0x52, script: 0x5, flags: 0x4}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, + 20: {region: 0x24, script: 0x5, flags: 0x4}, + 21: {region: 0x53, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, + 24: {region: 0x53, script: 0x5, flags: 0x2}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, + 29: {region: 0x53, script: 0x5, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, + 31: {region: 0x53, script: 0x5, flags: 0x2}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, + 42: {region: 0x4a, script: 0x5, flags: 0x4}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, + 63: {region: 0x53, script: 0x5, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, + 71: {region: 0x24, script: 0x5, flags: 0x4}, + 72: {region: 0x53, script: 0x20, flags: 0x4}, + 73: {region: 0x24, script: 0x5, flags: 0x2}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, + 75: {region: 0x53, script: 0x3b, flags: 0x4}, + 76: {region: 0x53, script: 0x3b, flags: 0x2}, + 77: {region: 0x53, script: 0x3b, flags: 0x0}, + 78: {region: 0x2f, script: 0x3c, flags: 0x4}, + 79: {region: 0x3e, script: 0x3c, flags: 0x4}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, +} + +type likelyLangScript struct { + lang uint16 + script uint16 + flags uint8 +} + +// likelyRegion is a lookup table, indexed by regionID, for the most likely +// languages and scripts given incomplete information. If more entries exist +// for a given regionID, lang and script are the index and size respectively +// of the list in likelyRegionList. +// TODO: exclude containers and user-definable regions from the list. +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, + 35: {lang: 0x3a, script: 0x5, flags: 0x0}, + 36: {lang: 0x0, script: 0x2, flags: 0x1}, + 39: {lang: 0x2, script: 0x2, flags: 0x1}, + 40: {lang: 0x4, script: 0x2, flags: 0x1}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, + 51: {lang: 0x6, script: 0x2, flags: 0x1}, + 53: {lang: 0xa5, script: 0xe, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 56: {lang: 0x7e, script: 0x20, flags: 0x0}, + 57: {lang: 0x3a, script: 0x5, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 67: {lang: 0x8, script: 0x2, flags: 0x1}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, + 71: {lang: 0x71, script: 0x20, flags: 0x0}, + 73: {lang: 0x512, script: 0x3e, flags: 0x2}, + 74: {lang: 0x31f, script: 0x5, flags: 0x2}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 83: {lang: 0xa, script: 0x4, flags: 0x1}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, + 108: {lang: 0x3a, script: 0x5, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, +} + +// likelyRegionList holds lists info associated with likelyRegion. +// Size: 558 bytes, 93 elements +var likelyRegionList = [93]likelyLangScript{ + 0: {lang: 0x148, script: 0x5, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, + 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, + 7: {lang: 0x432, script: 0x20, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, + 9: {lang: 0x351, script: 0x22, flags: 0x0}, + 10: {lang: 0x529, script: 0x3b, flags: 0x0}, + 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, + 14: {lang: 0x136, script: 0x34, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, + 16: {lang: 0x3a, script: 0x5, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 18: {lang: 0x27, script: 0x2c, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, + 20: {lang: 0x26a, script: 0x5, flags: 0x2}, + 21: {lang: 0x512, script: 0x3e, flags: 0x2}, + 22: {lang: 0x210, script: 0x2e, flags: 0x0}, + 23: {lang: 0x5, script: 0x20, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, + 25: {lang: 0x136, script: 0x34, flags: 0x0}, + 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, + 28: {lang: 0x31f, script: 0x5, flags: 0x0}, + 29: {lang: 0x1be, script: 0x22, flags: 0x0}, + 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, + 32: {lang: 0x148, script: 0x5, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, + 35: {lang: 0xe6, script: 0x5, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, + 37: {lang: 0x3a, script: 0x5, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, + 41: {lang: 0x3a, script: 0x5, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, + 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, + 49: {lang: 0x30b, script: 0x20, flags: 0x0}, + 50: {lang: 0x242, script: 0x5, flags: 0x0}, + 51: {lang: 0x529, script: 0x3c, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 53: {lang: 0x3a, script: 0x5, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, + 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 57: {lang: 0x88, script: 0x22, flags: 0x0}, + 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 60: {lang: 0xbe, script: 0x22, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, + 62: {lang: 0x7e, script: 0x20, flags: 0x0}, + 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, + 66: {lang: 0x512, script: 0x3e, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, + 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 69: {lang: 0x3a, script: 0x5, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 72: {lang: 0x35, script: 0x5, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, + 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, + 76: {lang: 0x467, script: 0x20, flags: 0x0}, + 77: {lang: 0x148, script: 0x5, flags: 0x0}, + 78: {lang: 0x3a, script: 0x5, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, + 81: {lang: 0x58, script: 0x5, flags: 0x0}, + 82: {lang: 0x219, script: 0x20, flags: 0x0}, + 83: {lang: 0x81, script: 0x34, flags: 0x0}, + 84: {lang: 0x529, script: 0x3c, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, + 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 87: {lang: 0x512, script: 0x3e, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, + 90: {lang: 0x432, script: 0x20, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 92: {lang: 0x446, script: 0x5, flags: 0x0}, +} + +type likelyTag struct { + lang uint16 + region uint16 + script uint16 +} + +// Size: 198 bytes, 33 elements +var likelyRegionGroup = [33]likelyTag{ + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, + 14: {lang: 0x529, region: 0x53, script: 0x3b}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, + 22: {lang: 0x529, region: 0x53, script: 0x3b}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, +} + +// Size: 264 bytes, 33 elements +var regionContainment = [33]uint64{ + // Entry 0 - 1F + 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, + 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, + 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, + 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, + 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, + 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, + 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, + // Entry 20 - 3F + 0x0000000100000000, +} + +// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +// where each set holds all groupings that are directly connected in a region +// containment graph. +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, + 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, + 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, + 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, + 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, + 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, + 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, + 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, + // Entry 40 - 7F + 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, + 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, + // Entry 80 - BF + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, + // Entry C0 - FF + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + // Entry 100 - 13F + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, + // Entry 140 - 17F + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, +} + +// regionInclusionBits is an array of bit vectors where every vector represents +// a set of region groupings. These sets are used to compute the distance +// between two regions for the purpose of language matching. +// Size: 584 bytes, 73 elements +var regionInclusionBits = [73]uint64{ + // Entry 0 - 1F + 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, + 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, + 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, + 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, + 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, + 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, + 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, + 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, + // Entry 20 - 3F + 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, + 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, + 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, + 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, + 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, + 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, + 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, + // Entry 40 - 5F + 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, + 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, + 0x0000000102020001, +} + +// regionInclusionNext marks, for each entry in regionInclusionBits, the set of +// all groups that are reachable from the groups set in the respective entry. +// Size: 73 bytes, 73 elements +var regionInclusionNext = [73]uint8{ + // Entry 0 - 3F + 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, + 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, + 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, + 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, + 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, + 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, + 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, + 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, + // Entry 40 - 7F + 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, + 0x43, +} + +type parentRel struct { + lang uint16 + script uint16 + maxScript uint16 + toRegion uint16 + fromRegion []uint16 +} + +// Size: 414 bytes, 5 elements +var parents = [5]parentRel{ + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, +} + +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go new file mode 100644 index 0000000..e7afd31 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tags.go @@ -0,0 +1,48 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Language { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +// Und is the root language. +var Und Tag diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go new file mode 100644 index 0000000..1cc004a --- /dev/null +++ b/vendor/golang.org/x/text/internal/match.go @@ -0,0 +1,67 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package internal + +// This file contains matchers that implement CLDR inheritance. +// +// See https://unicode.org/reports/tr35/#Locale_Inheritance. +// +// Some of the inheritance described in this document is already handled by +// the cldr package. + +import ( + "golang.org/x/text/language" +) + +// TODO: consider if (some of the) matching algorithm needs to be public after +// getting some feel about what is generic and what is specific. + +// NewInheritanceMatcher returns a matcher that matches based on the inheritance +// chain. +// +// The matcher uses canonicalization and the parent relationship to find a +// match. The resulting match will always be either Und or a language with the +// same language and script as the requested language. It will not match +// languages for which there is understood to be mutual or one-directional +// intelligibility. +// +// A Match will indicate an Exact match if the language matches after +// canonicalization and High if the matched tag is a parent. +func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher { + tags := &InheritanceMatcher{make(map[language.Tag]int)} + for i, tag := range t { + ct, err := language.All.Canonicalize(tag) + if err != nil { + ct = tag + } + tags.index[ct] = i + } + return tags +} + +type InheritanceMatcher struct { + index map[language.Tag]int +} + +func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) { + for _, t := range want { + ct, err := language.All.Canonicalize(t) + if err != nil { + ct = t + } + conf := language.Exact + for { + if index, ok := m.index[ct]; ok { + return ct, index, conf + } + if ct == language.Und { + break + } + ct = ct.Parent() + conf = language.High + } + } + return language.Und, 0, language.No +} diff --git a/vendor/golang.org/x/text/internal/number/common.go b/vendor/golang.org/x/text/internal/number/common.go new file mode 100644 index 0000000..a6e9c8e --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/common.go @@ -0,0 +1,55 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package number + +import ( + "unicode/utf8" + + "golang.org/x/text/internal/language/compact" +) + +// A system identifies a CLDR numbering system. +type system byte + +type systemData struct { + id system + digitSize byte // number of UTF-8 bytes per digit + zero [utf8.UTFMax]byte // UTF-8 sequence of zero digit. +} + +// A SymbolType identifies a symbol of a specific kind. +type SymbolType int + +const ( + SymDecimal SymbolType = iota + SymGroup + SymList + SymPercentSign + SymPlusSign + SymMinusSign + SymExponential + SymSuperscriptingExponent + SymPerMille + SymInfinity + SymNan + SymTimeSeparator + + NumSymbolTypes +) + +const hasNonLatnMask = 0x8000 + +// symOffset is an offset into altSymData if the bit indicated by hasNonLatnMask +// is not 0 (with this bit masked out), and an offset into symIndex otherwise. +// +// TODO: this type can be a byte again if we use an indirection into altsymData +// and introduce an alt -> offset slice (the length of this will be number of +// alternatives plus 1). This also allows getting rid of the compactTag field +// in altSymData. In total this will save about 1K. +type symOffset uint16 + +type altSymData struct { + compactTag compact.ID + symIndex symOffset + system system +} diff --git a/vendor/golang.org/x/text/internal/number/decimal.go b/vendor/golang.org/x/text/internal/number/decimal.go new file mode 100644 index 0000000..e128cf3 --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/decimal.go @@ -0,0 +1,500 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate stringer -type RoundingMode + +package number + +import ( + "math" + "strconv" +) + +// RoundingMode determines how a number is rounded to the desired precision. +type RoundingMode byte + +const ( + ToNearestEven RoundingMode = iota // towards the nearest integer, or towards an even number if equidistant. + ToNearestZero // towards the nearest integer, or towards zero if equidistant. + ToNearestAway // towards the nearest integer, or away from zero if equidistant. + ToPositiveInf // towards infinity + ToNegativeInf // towards negative infinity + ToZero // towards zero + AwayFromZero // away from zero + numModes +) + +const maxIntDigits = 20 + +// A Decimal represents a floating point number in decimal format. +// Digits represents a number [0, 1.0), and the absolute value represented by +// Decimal is Digits * 10^Exp. Leading and trailing zeros may be omitted and Exp +// may point outside a valid position in Digits. +// +// Examples: +// +// Number Decimal +// 12345 Digits: [1, 2, 3, 4, 5], Exp: 5 +// 12.345 Digits: [1, 2, 3, 4, 5], Exp: 2 +// 12000 Digits: [1, 2], Exp: 5 +// 12000.00 Digits: [1, 2], Exp: 5 +// 0.00123 Digits: [1, 2, 3], Exp: -2 +// 0 Digits: [], Exp: 0 +type Decimal struct { + digits + + buf [maxIntDigits]byte +} + +type digits struct { + Digits []byte // mantissa digits, big-endian + Exp int32 // exponent + Neg bool + Inf bool // Takes precedence over Digits and Exp. + NaN bool // Takes precedence over Inf. +} + +// Digits represents a floating point number represented in digits of the +// base in which a number is to be displayed. It is similar to Decimal, but +// keeps track of trailing fraction zeros and the comma placement for +// engineering notation. Digits must have at least one digit. +// +// Examples: +// +// Number Decimal +// decimal +// 12345 Digits: [1, 2, 3, 4, 5], Exp: 5 End: 5 +// 12.345 Digits: [1, 2, 3, 4, 5], Exp: 2 End: 5 +// 12000 Digits: [1, 2], Exp: 5 End: 5 +// 12000.00 Digits: [1, 2], Exp: 5 End: 7 +// 0.00123 Digits: [1, 2, 3], Exp: -2 End: 3 +// 0 Digits: [], Exp: 0 End: 1 +// scientific (actual exp is Exp - Comma) +// 0e0 Digits: [0], Exp: 1, End: 1, Comma: 1 +// .0e0 Digits: [0], Exp: 0, End: 1, Comma: 0 +// 0.0e0 Digits: [0], Exp: 1, End: 2, Comma: 1 +// 1.23e4 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 1 +// .123e5 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 0 +// engineering +// 12.3e3 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 2 +type Digits struct { + digits + // End indicates the end position of the number. + End int32 // For decimals Exp <= End. For scientific len(Digits) <= End. + // Comma is used for the comma position for scientific (always 0 or 1) and + // engineering notation (always 0, 1, 2, or 3). + Comma uint8 + // IsScientific indicates whether this number is to be rendered as a + // scientific number. + IsScientific bool +} + +func (d *Digits) NumFracDigits() int { + if d.Exp >= d.End { + return 0 + } + return int(d.End - d.Exp) +} + +// normalize returns a new Decimal with leading and trailing zeros removed. +func (d *Decimal) normalize() (n Decimal) { + n = *d + b := n.Digits + // Strip leading zeros. Resulting number of digits is significant digits. + for len(b) > 0 && b[0] == 0 { + b = b[1:] + n.Exp-- + } + // Strip trailing zeros + for len(b) > 0 && b[len(b)-1] == 0 { + b = b[:len(b)-1] + } + if len(b) == 0 { + n.Exp = 0 + } + n.Digits = b + return n +} + +func (d *Decimal) clear() { + b := d.Digits + if b == nil { + b = d.buf[:0] + } + *d = Decimal{} + d.Digits = b[:0] +} + +func (x *Decimal) String() string { + if x.NaN { + return "NaN" + } + var buf []byte + if x.Neg { + buf = append(buf, '-') + } + if x.Inf { + buf = append(buf, "Inf"...) + return string(buf) + } + switch { + case len(x.Digits) == 0: + buf = append(buf, '0') + case x.Exp <= 0: + // 0.00ddd + buf = append(buf, "0."...) + buf = appendZeros(buf, -int(x.Exp)) + buf = appendDigits(buf, x.Digits) + + case /* 0 < */ int(x.Exp) < len(x.Digits): + // dd.ddd + buf = appendDigits(buf, x.Digits[:x.Exp]) + buf = append(buf, '.') + buf = appendDigits(buf, x.Digits[x.Exp:]) + + default: // len(x.Digits) <= x.Exp + // ddd00 + buf = appendDigits(buf, x.Digits) + buf = appendZeros(buf, int(x.Exp)-len(x.Digits)) + } + return string(buf) +} + +func appendDigits(buf []byte, digits []byte) []byte { + for _, c := range digits { + buf = append(buf, c+'0') + } + return buf +} + +// appendZeros appends n 0 digits to buf and returns buf. +func appendZeros(buf []byte, n int) []byte { + for ; n > 0; n-- { + buf = append(buf, '0') + } + return buf +} + +func (d *digits) round(mode RoundingMode, n int) { + if n >= len(d.Digits) { + return + } + // Make rounding decision: The result mantissa is truncated ("rounded down") + // by default. Decide if we need to increment, or "round up", the (unsigned) + // mantissa. + inc := false + switch mode { + case ToNegativeInf: + inc = d.Neg + case ToPositiveInf: + inc = !d.Neg + case ToZero: + // nothing to do + case AwayFromZero: + inc = true + case ToNearestEven: + inc = d.Digits[n] > 5 || d.Digits[n] == 5 && + (len(d.Digits) > n+1 || n == 0 || d.Digits[n-1]&1 != 0) + case ToNearestAway: + inc = d.Digits[n] >= 5 + case ToNearestZero: + inc = d.Digits[n] > 5 || d.Digits[n] == 5 && len(d.Digits) > n+1 + default: + panic("unreachable") + } + if inc { + d.roundUp(n) + } else { + d.roundDown(n) + } +} + +// roundFloat rounds a floating point number. +func (r RoundingMode) roundFloat(x float64) float64 { + // Make rounding decision: The result mantissa is truncated ("rounded down") + // by default. Decide if we need to increment, or "round up", the (unsigned) + // mantissa. + abs := x + if x < 0 { + abs = -x + } + i, f := math.Modf(abs) + if f == 0.0 { + return x + } + inc := false + switch r { + case ToNegativeInf: + inc = x < 0 + case ToPositiveInf: + inc = x >= 0 + case ToZero: + // nothing to do + case AwayFromZero: + inc = true + case ToNearestEven: + // TODO: check overflow + inc = f > 0.5 || f == 0.5 && int64(i)&1 != 0 + case ToNearestAway: + inc = f >= 0.5 + case ToNearestZero: + inc = f > 0.5 + default: + panic("unreachable") + } + if inc { + i += 1 + } + if abs != x { + i = -i + } + return i +} + +func (x *digits) roundUp(n int) { + if n < 0 || n >= len(x.Digits) { + return // nothing to do + } + // find first digit < 9 + for n > 0 && x.Digits[n-1] >= 9 { + n-- + } + + if n == 0 { + // all digits are 9s => round up to 1 and update exponent + x.Digits[0] = 1 // ok since len(x.Digits) > n + x.Digits = x.Digits[:1] + x.Exp++ + return + } + x.Digits[n-1]++ + x.Digits = x.Digits[:n] + // x already trimmed +} + +func (x *digits) roundDown(n int) { + if n < 0 || n >= len(x.Digits) { + return // nothing to do + } + x.Digits = x.Digits[:n] + trim(x) +} + +// trim cuts off any trailing zeros from x's mantissa; +// they are meaningless for the value of x. +func trim(x *digits) { + i := len(x.Digits) + for i > 0 && x.Digits[i-1] == 0 { + i-- + } + x.Digits = x.Digits[:i] + if i == 0 { + x.Exp = 0 + } +} + +// A Converter converts a number into decimals according to the given rounding +// criteria. +type Converter interface { + Convert(d *Decimal, r RoundingContext) +} + +const ( + signed = true + unsigned = false +) + +// Convert converts the given number to the decimal representation using the +// supplied RoundingContext. +func (d *Decimal) Convert(r RoundingContext, number interface{}) { + switch f := number.(type) { + case Converter: + d.clear() + f.Convert(d, r) + case float32: + d.ConvertFloat(r, float64(f), 32) + case float64: + d.ConvertFloat(r, f, 64) + case int: + d.ConvertInt(r, signed, uint64(f)) + case int8: + d.ConvertInt(r, signed, uint64(f)) + case int16: + d.ConvertInt(r, signed, uint64(f)) + case int32: + d.ConvertInt(r, signed, uint64(f)) + case int64: + d.ConvertInt(r, signed, uint64(f)) + case uint: + d.ConvertInt(r, unsigned, uint64(f)) + case uint8: + d.ConvertInt(r, unsigned, uint64(f)) + case uint16: + d.ConvertInt(r, unsigned, uint64(f)) + case uint32: + d.ConvertInt(r, unsigned, uint64(f)) + case uint64: + d.ConvertInt(r, unsigned, f) + + default: + d.NaN = true + // TODO: + // case string: if produced by strconv, allows for easy arbitrary pos. + // case reflect.Value: + // case big.Float + // case big.Int + // case big.Rat? + // catch underlyings using reflect or will this already be done by the + // message package? + } +} + +// ConvertInt converts an integer to decimals. +func (d *Decimal) ConvertInt(r RoundingContext, signed bool, x uint64) { + if r.Increment > 0 { + // TODO: if uint64 is too large, fall back to float64 + if signed { + d.ConvertFloat(r, float64(int64(x)), 64) + } else { + d.ConvertFloat(r, float64(x), 64) + } + return + } + d.clear() + if signed && int64(x) < 0 { + x = uint64(-int64(x)) + d.Neg = true + } + d.fillIntDigits(x) + d.Exp = int32(len(d.Digits)) +} + +// ConvertFloat converts a floating point number to decimals. +func (d *Decimal) ConvertFloat(r RoundingContext, x float64, size int) { + d.clear() + if math.IsNaN(x) { + d.NaN = true + return + } + // Simple case: decimal notation + if r.Increment > 0 { + scale := int(r.IncrementScale) + mult := 1.0 + if scale >= len(scales) { + mult = math.Pow(10, float64(scale)) + } else { + mult = scales[scale] + } + // We multiply x instead of dividing inc as it gives less rounding + // issues. + x *= mult + x /= float64(r.Increment) + x = r.Mode.roundFloat(x) + x *= float64(r.Increment) + x /= mult + } + + abs := x + if x < 0 { + d.Neg = true + abs = -x + } + if math.IsInf(abs, 1) { + d.Inf = true + return + } + + // By default we get the exact decimal representation. + verb := byte('g') + prec := -1 + // As the strconv API does not return the rounding accuracy, we can only + // round using ToNearestEven. + if r.Mode == ToNearestEven { + if n := r.RoundSignificantDigits(); n >= 0 { + prec = n + } else if n = r.RoundFractionDigits(); n >= 0 { + prec = n + verb = 'f' + } + } else { + // TODO: At this point strconv's rounding is imprecise to the point that + // it is not usable for this purpose. + // See https://github.com/golang/go/issues/21714 + // If rounding is requested, we ask for a large number of digits and + // round from there to simulate rounding only once. + // Ideally we would have strconv export an AppendDigits that would take + // a rounding mode and/or return an accuracy. Something like this would + // work: + // AppendDigits(dst []byte, x float64, base, size, prec int) (digits []byte, exp, accuracy int) + hasPrec := r.RoundSignificantDigits() >= 0 + hasScale := r.RoundFractionDigits() >= 0 + if hasPrec || hasScale { + // prec is the number of mantissa bits plus some extra for safety. + // We need at least the number of mantissa bits as decimals to + // accurately represent the floating point without rounding, as each + // bit requires one more decimal to represent: 0.5, 0.25, 0.125, ... + prec = 60 + } + } + + b := strconv.AppendFloat(d.Digits[:0], abs, verb, prec, size) + i := 0 + k := 0 + beforeDot := 1 + for i < len(b) { + if c := b[i]; '0' <= c && c <= '9' { + b[k] = c - '0' + k++ + d.Exp += int32(beforeDot) + } else if c == '.' { + beforeDot = 0 + d.Exp = int32(k) + } else { + break + } + i++ + } + d.Digits = b[:k] + if i != len(b) { + i += len("e") + pSign := i + exp := 0 + for i++; i < len(b); i++ { + exp *= 10 + exp += int(b[i] - '0') + } + if b[pSign] == '-' { + exp = -exp + } + d.Exp = int32(exp) + 1 + } +} + +func (d *Decimal) fillIntDigits(x uint64) { + if cap(d.Digits) < maxIntDigits { + d.Digits = d.buf[:] + } else { + d.Digits = d.buf[:maxIntDigits] + } + i := 0 + for ; x > 0; x /= 10 { + d.Digits[i] = byte(x % 10) + i++ + } + d.Digits = d.Digits[:i] + for p := 0; p < i; p++ { + i-- + d.Digits[p], d.Digits[i] = d.Digits[i], d.Digits[p] + } +} + +var scales [70]float64 + +func init() { + x := 1.0 + for i := range scales { + scales[i] = x + x *= 10 + } +} diff --git a/vendor/golang.org/x/text/internal/number/format.go b/vendor/golang.org/x/text/internal/number/format.go new file mode 100644 index 0000000..cd94c5d --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/format.go @@ -0,0 +1,535 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package number + +import ( + "strconv" + "unicode/utf8" + + "golang.org/x/text/language" +) + +// TODO: +// - grouping of fractions +// - allow user-defined superscript notation (such as 4) +// - same for non-breaking spaces, like   + +// A VisibleDigits computes digits, comma placement and trailing zeros as they +// will be shown to the user. +type VisibleDigits interface { + Digits(buf []byte, t language.Tag, scale int) Digits + // TODO: Do we also need to add the verb or pass a format.State? +} + +// Formatting proceeds along the following lines: +// 0) Compose rounding information from format and context. +// 1) Convert a number into a Decimal. +// 2) Sanitize Decimal by adding trailing zeros, removing leading digits, and +// (non-increment) rounding. The Decimal that results from this is suitable +// for determining the plural form. +// 3) Render the Decimal in the localized form. + +// Formatter contains all the information needed to render a number. +type Formatter struct { + Pattern + Info +} + +func (f *Formatter) init(t language.Tag, index []uint8) { + f.Info = InfoFromTag(t) + f.Pattern = formats[index[tagToID(t)]] +} + +// InitPattern initializes a Formatter for the given Pattern. +func (f *Formatter) InitPattern(t language.Tag, pat *Pattern) { + f.Info = InfoFromTag(t) + f.Pattern = *pat +} + +// InitDecimal initializes a Formatter using the default Pattern for the given +// language. +func (f *Formatter) InitDecimal(t language.Tag) { + f.init(t, tagToDecimal) +} + +// InitScientific initializes a Formatter using the default Pattern for the +// given language. +func (f *Formatter) InitScientific(t language.Tag) { + f.init(t, tagToScientific) + f.Pattern.MinFractionDigits = 0 + f.Pattern.MaxFractionDigits = -1 +} + +// InitEngineering initializes a Formatter using the default Pattern for the +// given language. +func (f *Formatter) InitEngineering(t language.Tag) { + f.init(t, tagToScientific) + f.Pattern.MinFractionDigits = 0 + f.Pattern.MaxFractionDigits = -1 + f.Pattern.MaxIntegerDigits = 3 + f.Pattern.MinIntegerDigits = 1 +} + +// InitPercent initializes a Formatter using the default Pattern for the given +// language. +func (f *Formatter) InitPercent(t language.Tag) { + f.init(t, tagToPercent) +} + +// InitPerMille initializes a Formatter using the default Pattern for the given +// language. +func (f *Formatter) InitPerMille(t language.Tag) { + f.init(t, tagToPercent) + f.Pattern.DigitShift = 3 +} + +func (f *Formatter) Append(dst []byte, x interface{}) []byte { + var d Decimal + r := f.RoundingContext + d.Convert(r, x) + return f.Render(dst, FormatDigits(&d, r)) +} + +func FormatDigits(d *Decimal, r RoundingContext) Digits { + if r.isScientific() { + return scientificVisibleDigits(r, d) + } + return decimalVisibleDigits(r, d) +} + +func (f *Formatter) Format(dst []byte, d *Decimal) []byte { + return f.Render(dst, FormatDigits(d, f.RoundingContext)) +} + +func (f *Formatter) Render(dst []byte, d Digits) []byte { + var result []byte + var postPrefix, preSuffix int + if d.IsScientific { + result, postPrefix, preSuffix = appendScientific(dst, f, &d) + } else { + result, postPrefix, preSuffix = appendDecimal(dst, f, &d) + } + if f.PadRune == 0 { + return result + } + width := int(f.FormatWidth) + if count := utf8.RuneCount(result); count < width { + insertPos := 0 + switch f.Flags & PadMask { + case PadAfterPrefix: + insertPos = postPrefix + case PadBeforeSuffix: + insertPos = preSuffix + case PadAfterSuffix: + insertPos = len(result) + } + num := width - count + pad := [utf8.UTFMax]byte{' '} + sz := 1 + if r := f.PadRune; r != 0 { + sz = utf8.EncodeRune(pad[:], r) + } + extra := sz * num + if n := len(result) + extra; n < cap(result) { + result = result[:n] + copy(result[insertPos+extra:], result[insertPos:]) + } else { + buf := make([]byte, n) + copy(buf, result[:insertPos]) + copy(buf[insertPos+extra:], result[insertPos:]) + result = buf + } + for ; num > 0; num-- { + insertPos += copy(result[insertPos:], pad[:sz]) + } + } + return result +} + +// decimalVisibleDigits converts d according to the RoundingContext. Note that +// the exponent may change as a result of this operation. +func decimalVisibleDigits(r RoundingContext, d *Decimal) Digits { + if d.NaN || d.Inf { + return Digits{digits: digits{Neg: d.Neg, NaN: d.NaN, Inf: d.Inf}} + } + n := Digits{digits: d.normalize().digits} + + exp := n.Exp + exp += int32(r.DigitShift) + + // Cap integer digits. Remove *most-significant* digits. + if r.MaxIntegerDigits > 0 { + if p := int(exp) - int(r.MaxIntegerDigits); p > 0 { + if p > len(n.Digits) { + p = len(n.Digits) + } + if n.Digits = n.Digits[p:]; len(n.Digits) == 0 { + exp = 0 + } else { + exp -= int32(p) + } + // Strip leading zeros. + for len(n.Digits) > 0 && n.Digits[0] == 0 { + n.Digits = n.Digits[1:] + exp-- + } + } + } + + // Rounding if not already done by Convert. + p := len(n.Digits) + if maxSig := int(r.MaxSignificantDigits); maxSig > 0 { + p = maxSig + } + if maxFrac := int(r.MaxFractionDigits); maxFrac >= 0 { + if cap := int(exp) + maxFrac; cap < p { + p = int(exp) + maxFrac + } + if p < 0 { + p = 0 + } + } + n.round(r.Mode, p) + + // set End (trailing zeros) + n.End = int32(len(n.Digits)) + if n.End == 0 { + exp = 0 + if r.MinFractionDigits > 0 { + n.End = int32(r.MinFractionDigits) + } + if p := int32(r.MinSignificantDigits) - 1; p > n.End { + n.End = p + } + } else { + if end := exp + int32(r.MinFractionDigits); end > n.End { + n.End = end + } + if n.End < int32(r.MinSignificantDigits) { + n.End = int32(r.MinSignificantDigits) + } + } + n.Exp = exp + return n +} + +// appendDecimal appends a formatted number to dst. It returns two possible +// insertion points for padding. +func appendDecimal(dst []byte, f *Formatter, n *Digits) (b []byte, postPre, preSuf int) { + if dst, ok := f.renderSpecial(dst, n); ok { + return dst, 0, len(dst) + } + digits := n.Digits + exp := n.Exp + + // Split in integer and fraction part. + var intDigits, fracDigits []byte + numInt := 0 + numFrac := int(n.End - n.Exp) + if exp > 0 { + numInt = int(exp) + if int(exp) >= len(digits) { // ddddd | ddddd00 + intDigits = digits + } else { // ddd.dd + intDigits = digits[:exp] + fracDigits = digits[exp:] + } + } else { + fracDigits = digits + } + + neg := n.Neg + affix, suffix := f.getAffixes(neg) + dst = appendAffix(dst, f, affix, neg) + savedLen := len(dst) + + minInt := int(f.MinIntegerDigits) + if minInt == 0 && f.MinSignificantDigits > 0 { + minInt = 1 + } + // add leading zeros + for i := minInt; i > numInt; i-- { + dst = f.AppendDigit(dst, 0) + if f.needsSep(i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + i := 0 + for ; i < len(intDigits); i++ { + dst = f.AppendDigit(dst, intDigits[i]) + if f.needsSep(numInt - i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + for ; i < numInt; i++ { + dst = f.AppendDigit(dst, 0) + if f.needsSep(numInt - i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + + if numFrac > 0 || f.Flags&AlwaysDecimalSeparator != 0 { + dst = append(dst, f.Symbol(SymDecimal)...) + } + // Add trailing zeros + i = 0 + for n := -int(n.Exp); i < n; i++ { + dst = f.AppendDigit(dst, 0) + } + for _, d := range fracDigits { + i++ + dst = f.AppendDigit(dst, d) + } + for ; i < numFrac; i++ { + dst = f.AppendDigit(dst, 0) + } + return appendAffix(dst, f, suffix, neg), savedLen, len(dst) +} + +func scientificVisibleDigits(r RoundingContext, d *Decimal) Digits { + if d.NaN || d.Inf { + return Digits{digits: digits{Neg: d.Neg, NaN: d.NaN, Inf: d.Inf}} + } + n := Digits{digits: d.normalize().digits, IsScientific: true} + + // Normalize to have at least one digit. This simplifies engineering + // notation. + if len(n.Digits) == 0 { + n.Digits = append(n.Digits, 0) + n.Exp = 1 + } + + // Significant digits are transformed by the parser for scientific notation + // and do not need to be handled here. + maxInt, numInt := int(r.MaxIntegerDigits), int(r.MinIntegerDigits) + if numInt == 0 { + numInt = 1 + } + + // If a maximum number of integers is specified, the minimum must be 1 + // and the exponent is grouped by this number (e.g. for engineering) + if maxInt > numInt { + // Correct the exponent to reflect a single integer digit. + numInt = 1 + // engineering + // 0.01234 ([12345]e-1) -> 1.2345e-2 12.345e-3 + // 12345 ([12345]e+5) -> 1.2345e4 12.345e3 + d := int(n.Exp-1) % maxInt + if d < 0 { + d += maxInt + } + numInt += d + } + + p := len(n.Digits) + if maxSig := int(r.MaxSignificantDigits); maxSig > 0 { + p = maxSig + } + if maxFrac := int(r.MaxFractionDigits); maxFrac >= 0 && numInt+maxFrac < p { + p = numInt + maxFrac + } + n.round(r.Mode, p) + + n.Comma = uint8(numInt) + n.End = int32(len(n.Digits)) + if minSig := int32(r.MinFractionDigits) + int32(numInt); n.End < minSig { + n.End = minSig + } + return n +} + +// appendScientific appends a formatted number to dst. It returns two possible +// insertion points for padding. +func appendScientific(dst []byte, f *Formatter, n *Digits) (b []byte, postPre, preSuf int) { + if dst, ok := f.renderSpecial(dst, n); ok { + return dst, 0, 0 + } + digits := n.Digits + numInt := int(n.Comma) + numFrac := int(n.End) - int(n.Comma) + + var intDigits, fracDigits []byte + if numInt <= len(digits) { + intDigits = digits[:numInt] + fracDigits = digits[numInt:] + } else { + intDigits = digits + } + neg := n.Neg + affix, suffix := f.getAffixes(neg) + dst = appendAffix(dst, f, affix, neg) + savedLen := len(dst) + + i := 0 + for ; i < len(intDigits); i++ { + dst = f.AppendDigit(dst, intDigits[i]) + if f.needsSep(numInt - i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + for ; i < numInt; i++ { + dst = f.AppendDigit(dst, 0) + if f.needsSep(numInt - i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + + if numFrac > 0 || f.Flags&AlwaysDecimalSeparator != 0 { + dst = append(dst, f.Symbol(SymDecimal)...) + } + i = 0 + for ; i < len(fracDigits); i++ { + dst = f.AppendDigit(dst, fracDigits[i]) + } + for ; i < numFrac; i++ { + dst = f.AppendDigit(dst, 0) + } + + // exp + buf := [12]byte{} + // TODO: use exponential if superscripting is not available (no Latin + // numbers or no tags) and use exponential in all other cases. + exp := n.Exp - int32(n.Comma) + exponential := f.Symbol(SymExponential) + if exponential == "E" { + dst = append(dst, "\u202f"...) // NARROW NO-BREAK SPACE + dst = append(dst, f.Symbol(SymSuperscriptingExponent)...) + dst = append(dst, "\u202f"...) // NARROW NO-BREAK SPACE + dst = f.AppendDigit(dst, 1) + dst = f.AppendDigit(dst, 0) + switch { + case exp < 0: + dst = append(dst, superMinus...) + exp = -exp + case f.Flags&AlwaysExpSign != 0: + dst = append(dst, superPlus...) + } + b = strconv.AppendUint(buf[:0], uint64(exp), 10) + for i := len(b); i < int(f.MinExponentDigits); i++ { + dst = append(dst, superDigits[0]...) + } + for _, c := range b { + dst = append(dst, superDigits[c-'0']...) + } + } else { + dst = append(dst, exponential...) + switch { + case exp < 0: + dst = append(dst, f.Symbol(SymMinusSign)...) + exp = -exp + case f.Flags&AlwaysExpSign != 0: + dst = append(dst, f.Symbol(SymPlusSign)...) + } + b = strconv.AppendUint(buf[:0], uint64(exp), 10) + for i := len(b); i < int(f.MinExponentDigits); i++ { + dst = f.AppendDigit(dst, 0) + } + for _, c := range b { + dst = f.AppendDigit(dst, c-'0') + } + } + return appendAffix(dst, f, suffix, neg), savedLen, len(dst) +} + +const ( + superMinus = "\u207B" // SUPERSCRIPT HYPHEN-MINUS + superPlus = "\u207A" // SUPERSCRIPT PLUS SIGN +) + +var ( + // Note: the digits are not sequential!!! + superDigits = []string{ + "\u2070", // SUPERSCRIPT DIGIT ZERO + "\u00B9", // SUPERSCRIPT DIGIT ONE + "\u00B2", // SUPERSCRIPT DIGIT TWO + "\u00B3", // SUPERSCRIPT DIGIT THREE + "\u2074", // SUPERSCRIPT DIGIT FOUR + "\u2075", // SUPERSCRIPT DIGIT FIVE + "\u2076", // SUPERSCRIPT DIGIT SIX + "\u2077", // SUPERSCRIPT DIGIT SEVEN + "\u2078", // SUPERSCRIPT DIGIT EIGHT + "\u2079", // SUPERSCRIPT DIGIT NINE + } +) + +func (f *Formatter) getAffixes(neg bool) (affix, suffix string) { + str := f.Affix + if str != "" { + if f.NegOffset > 0 { + if neg { + str = str[f.NegOffset:] + } else { + str = str[:f.NegOffset] + } + } + sufStart := 1 + str[0] + affix = str[1:sufStart] + suffix = str[sufStart+1:] + } + // TODO: introduce a NeedNeg sign to indicate if the left pattern already + // has a sign marked? + if f.NegOffset == 0 && (neg || f.Flags&AlwaysSign != 0) { + affix = "-" + affix + } + return affix, suffix +} + +func (f *Formatter) renderSpecial(dst []byte, d *Digits) (b []byte, ok bool) { + if d.NaN { + return fmtNaN(dst, f), true + } + if d.Inf { + return fmtInfinite(dst, f, d), true + } + return dst, false +} + +func fmtNaN(dst []byte, f *Formatter) []byte { + return append(dst, f.Symbol(SymNan)...) +} + +func fmtInfinite(dst []byte, f *Formatter, d *Digits) []byte { + affix, suffix := f.getAffixes(d.Neg) + dst = appendAffix(dst, f, affix, d.Neg) + dst = append(dst, f.Symbol(SymInfinity)...) + dst = appendAffix(dst, f, suffix, d.Neg) + return dst +} + +func appendAffix(dst []byte, f *Formatter, affix string, neg bool) []byte { + quoting := false + escaping := false + for _, r := range affix { + switch { + case escaping: + // escaping occurs both inside and outside of quotes + dst = append(dst, string(r)...) + escaping = false + case r == '\\': + escaping = true + case r == '\'': + quoting = !quoting + case quoting: + dst = append(dst, string(r)...) + case r == '%': + if f.DigitShift == 3 { + dst = append(dst, f.Symbol(SymPerMille)...) + } else { + dst = append(dst, f.Symbol(SymPercentSign)...) + } + case r == '-' || r == '+': + if neg { + dst = append(dst, f.Symbol(SymMinusSign)...) + } else if f.Flags&ElideSign == 0 { + dst = append(dst, f.Symbol(SymPlusSign)...) + } else { + dst = append(dst, ' ') + } + default: + dst = append(dst, string(r)...) + } + } + return dst +} diff --git a/vendor/golang.org/x/text/internal/number/number.go b/vendor/golang.org/x/text/internal/number/number.go new file mode 100644 index 0000000..e1d933c --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/number.go @@ -0,0 +1,152 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go + +// Package number contains tools and data for formatting numbers. +package number + +import ( + "unicode/utf8" + + "golang.org/x/text/internal/language/compact" + "golang.org/x/text/language" +) + +// Info holds number formatting configuration data. +type Info struct { + system systemData // numbering system information + symIndex symOffset // index to symbols +} + +// InfoFromLangID returns a Info for the given compact language identifier and +// numbering system identifier. If system is the empty string, the default +// numbering system will be taken for that language. +func InfoFromLangID(compactIndex compact.ID, numberSystem string) Info { + p := langToDefaults[compactIndex] + // Lookup the entry for the language. + pSymIndex := symOffset(0) // Default: Latin, default symbols + system, ok := systemMap[numberSystem] + if !ok { + // Take the value for the default numbering system. This is by far the + // most common case as an alternative numbering system is hardly used. + if p&hasNonLatnMask == 0 { // Latn digits. + pSymIndex = p + } else { // Non-Latn or multiple numbering systems. + // Take the first entry from the alternatives list. + data := langToAlt[p&^hasNonLatnMask] + pSymIndex = data.symIndex + system = data.system + } + } else { + langIndex := compactIndex + ns := system + outerLoop: + for ; ; p = langToDefaults[langIndex] { + if p&hasNonLatnMask == 0 { + if ns == 0 { + // The index directly points to the symbol data. + pSymIndex = p + break + } + // Move to the parent and retry. + langIndex = langIndex.Parent() + } else { + // The index points to a list of symbol data indexes. + for _, e := range langToAlt[p&^hasNonLatnMask:] { + if e.compactTag != langIndex { + if langIndex == 0 { + // The CLDR root defines full symbol information for + // all numbering systems (even though mostly by + // means of aliases). Fall back to the default entry + // for Latn if there is no data for the numbering + // system of this language. + if ns == 0 { + break + } + // Fall back to Latin and start from the original + // language. See + // https://unicode.org/reports/tr35/#Locale_Inheritance. + ns = numLatn + langIndex = compactIndex + continue outerLoop + } + // Fall back to parent. + langIndex = langIndex.Parent() + } else if e.system == ns { + pSymIndex = e.symIndex + break outerLoop + } + } + } + } + } + if int(system) >= len(numSysData) { // algorithmic + // Will generate ASCII digits in case the user inadvertently calls + // WriteDigit or Digit on it. + d := numSysData[0] + d.id = system + return Info{ + system: d, + symIndex: pSymIndex, + } + } + return Info{ + system: numSysData[system], + symIndex: pSymIndex, + } +} + +// InfoFromTag returns a Info for the given language tag. +func InfoFromTag(t language.Tag) Info { + return InfoFromLangID(tagToID(t), t.TypeForKey("nu")) +} + +// IsDecimal reports if the numbering system can convert decimal to native +// symbols one-to-one. +func (n Info) IsDecimal() bool { + return int(n.system.id) < len(numSysData) +} + +// WriteDigit writes the UTF-8 sequence for n corresponding to the given ASCII +// digit to dst and reports the number of bytes written. dst must be large +// enough to hold the rune (can be up to utf8.UTFMax bytes). +func (n Info) WriteDigit(dst []byte, asciiDigit rune) int { + copy(dst, n.system.zero[:n.system.digitSize]) + dst[n.system.digitSize-1] += byte(asciiDigit - '0') + return int(n.system.digitSize) +} + +// AppendDigit appends the UTF-8 sequence for n corresponding to the given digit +// to dst and reports the number of bytes written. dst must be large enough to +// hold the rune (can be up to utf8.UTFMax bytes). +func (n Info) AppendDigit(dst []byte, digit byte) []byte { + dst = append(dst, n.system.zero[:n.system.digitSize]...) + dst[len(dst)-1] += digit + return dst +} + +// Digit returns the digit for the numbering system for the corresponding ASCII +// value. For example, ni.Digit('3') could return '三'. Note that the argument +// is the rune constant '3', which equals 51, not the integer constant 3. +func (n Info) Digit(asciiDigit rune) rune { + var x [utf8.UTFMax]byte + n.WriteDigit(x[:], asciiDigit) + r, _ := utf8.DecodeRune(x[:]) + return r +} + +// Symbol returns the string for the given symbol type. +func (n Info) Symbol(t SymbolType) string { + return symData.Elem(int(symIndex[n.symIndex][t])) +} + +func formatForLang(t language.Tag, index []byte) *Pattern { + return &formats[index[tagToID(t)]] +} + +func tagToID(t language.Tag) compact.ID { + id, _ := compact.RegionalID(compact.Tag(t)) + return id +} diff --git a/vendor/golang.org/x/text/internal/number/pattern.go b/vendor/golang.org/x/text/internal/number/pattern.go new file mode 100644 index 0000000..06e5955 --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/pattern.go @@ -0,0 +1,485 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package number + +import ( + "errors" + "unicode/utf8" +) + +// This file contains a parser for the CLDR number patterns as described in +// https://unicode.org/reports/tr35/tr35-numbers.html#Number_Format_Patterns. +// +// The following BNF is derived from this standard. +// +// pattern := subpattern (';' subpattern)? +// subpattern := affix? number exponent? affix? +// number := decimal | sigDigits +// decimal := '#'* '0'* ('.' fraction)? | '#' | '0' +// fraction := '0'* '#'* +// sigDigits := '#'* '@' '@'* '#'* +// exponent := 'E' '+'? '0'* '0' +// padSpec := '*' \L +// +// Notes: +// - An affix pattern may contain any runes, but runes with special meaning +// should be escaped. +// - Sequences of digits, '#', and '@' in decimal and sigDigits may have +// interstitial commas. + +// TODO: replace special characters in affixes (-, +, ¤) with control codes. + +// Pattern holds information for formatting numbers. It is designed to hold +// information from CLDR number patterns. +// +// This pattern is precompiled for all patterns for all languages. Even though +// the number of patterns is not very large, we want to keep this small. +// +// This type is only intended for internal use. +type Pattern struct { + RoundingContext + + Affix string // includes prefix and suffix. First byte is prefix length. + Offset uint16 // Offset into Affix for prefix and suffix + NegOffset uint16 // Offset into Affix for negative prefix and suffix or 0. + PadRune rune + FormatWidth uint16 + + GroupingSize [2]uint8 + Flags PatternFlag +} + +// A RoundingContext indicates how a number should be converted to digits. +// It contains all information needed to determine the "visible digits" as +// required by the pluralization rules. +type RoundingContext struct { + // TODO: unify these two fields so that there is a more unambiguous meaning + // of how precision is handled. + MaxSignificantDigits int16 // -1 is unlimited + MaxFractionDigits int16 // -1 is unlimited + + Increment uint32 + IncrementScale uint8 // May differ from printed scale. + + Mode RoundingMode + + DigitShift uint8 // Number of decimals to shift. Used for % and ‰. + + // Number of digits. + MinIntegerDigits uint8 + + MaxIntegerDigits uint8 + MinFractionDigits uint8 + MinSignificantDigits uint8 + + MinExponentDigits uint8 +} + +// RoundSignificantDigits returns the number of significant digits an +// implementation of Convert may round to or n < 0 if there is no maximum or +// a maximum is not recommended. +func (r *RoundingContext) RoundSignificantDigits() (n int) { + if r.MaxFractionDigits == 0 && r.MaxSignificantDigits > 0 { + return int(r.MaxSignificantDigits) + } else if r.isScientific() && r.MaxIntegerDigits == 1 { + if r.MaxSignificantDigits == 0 || + int(r.MaxFractionDigits+1) == int(r.MaxSignificantDigits) { + // Note: don't add DigitShift: it is only used for decimals. + return int(r.MaxFractionDigits) + 1 + } + } + return -1 +} + +// RoundFractionDigits returns the number of fraction digits an implementation +// of Convert may round to or n < 0 if there is no maximum or a maximum is not +// recommended. +func (r *RoundingContext) RoundFractionDigits() (n int) { + if r.MinExponentDigits == 0 && + r.MaxSignificantDigits == 0 && + r.MaxFractionDigits >= 0 { + return int(r.MaxFractionDigits) + int(r.DigitShift) + } + return -1 +} + +// SetScale fixes the RoundingContext to a fixed number of fraction digits. +func (r *RoundingContext) SetScale(scale int) { + r.MinFractionDigits = uint8(scale) + r.MaxFractionDigits = int16(scale) +} + +func (r *RoundingContext) SetPrecision(prec int) { + r.MaxSignificantDigits = int16(prec) +} + +func (r *RoundingContext) isScientific() bool { + return r.MinExponentDigits > 0 +} + +func (f *Pattern) needsSep(pos int) bool { + p := pos - 1 + size := int(f.GroupingSize[0]) + if size == 0 || p == 0 { + return false + } + if p == size { + return true + } + if p -= size; p < 0 { + return false + } + // TODO: make second groupingsize the same as first if 0 so that we can + // avoid this check. + if x := int(f.GroupingSize[1]); x != 0 { + size = x + } + return p%size == 0 +} + +// A PatternFlag is a bit mask for the flag field of a Pattern. +type PatternFlag uint8 + +const ( + AlwaysSign PatternFlag = 1 << iota + ElideSign // Use space instead of plus sign. AlwaysSign must be true. + AlwaysExpSign + AlwaysDecimalSeparator + ParenthesisForNegative // Common pattern. Saves space. + + PadAfterNumber + PadAfterAffix + + PadBeforePrefix = 0 // Default + PadAfterPrefix = PadAfterAffix + PadBeforeSuffix = PadAfterNumber + PadAfterSuffix = PadAfterNumber | PadAfterAffix + PadMask = PadAfterNumber | PadAfterAffix +) + +type parser struct { + *Pattern + + leadingSharps int + + pos int + err error + doNotTerminate bool + groupingCount uint + hasGroup bool + buf []byte +} + +func (p *parser) setError(err error) { + if p.err == nil { + p.err = err + } +} + +func (p *parser) updateGrouping() { + if p.hasGroup && + 0 < p.groupingCount && p.groupingCount < 255 { + p.GroupingSize[1] = p.GroupingSize[0] + p.GroupingSize[0] = uint8(p.groupingCount) + } + p.groupingCount = 0 + p.hasGroup = true +} + +var ( + // TODO: more sensible and localizeable error messages. + errMultiplePadSpecifiers = errors.New("format: pattern has multiple pad specifiers") + errInvalidPadSpecifier = errors.New("format: invalid pad specifier") + errInvalidQuote = errors.New("format: invalid quote") + errAffixTooLarge = errors.New("format: prefix or suffix exceeds maximum UTF-8 length of 256 bytes") + errDuplicatePercentSign = errors.New("format: duplicate percent sign") + errDuplicatePermilleSign = errors.New("format: duplicate permille sign") + errUnexpectedEnd = errors.New("format: unexpected end of pattern") +) + +// ParsePattern extracts formatting information from a CLDR number pattern. +// +// See https://unicode.org/reports/tr35/tr35-numbers.html#Number_Format_Patterns. +func ParsePattern(s string) (f *Pattern, err error) { + p := parser{Pattern: &Pattern{}} + + s = p.parseSubPattern(s) + + if s != "" { + // Parse negative sub pattern. + if s[0] != ';' { + p.setError(errors.New("format: error parsing first sub pattern")) + return nil, p.err + } + neg := parser{Pattern: &Pattern{}} // just for extracting the affixes. + s = neg.parseSubPattern(s[len(";"):]) + p.NegOffset = uint16(len(p.buf)) + p.buf = append(p.buf, neg.buf...) + } + if s != "" { + p.setError(errors.New("format: spurious characters at end of pattern")) + } + if p.err != nil { + return nil, p.err + } + if affix := string(p.buf); affix == "\x00\x00" || affix == "\x00\x00\x00\x00" { + // No prefix or suffixes. + p.NegOffset = 0 + } else { + p.Affix = affix + } + if p.Increment == 0 { + p.IncrementScale = 0 + } + return p.Pattern, nil +} + +func (p *parser) parseSubPattern(s string) string { + s = p.parsePad(s, PadBeforePrefix) + s = p.parseAffix(s) + s = p.parsePad(s, PadAfterPrefix) + + s = p.parse(p.number, s) + p.updateGrouping() + + s = p.parsePad(s, PadBeforeSuffix) + s = p.parseAffix(s) + s = p.parsePad(s, PadAfterSuffix) + return s +} + +func (p *parser) parsePad(s string, f PatternFlag) (tail string) { + if len(s) >= 2 && s[0] == '*' { + r, sz := utf8.DecodeRuneInString(s[1:]) + if p.PadRune != 0 { + p.err = errMultiplePadSpecifiers + } else { + p.Flags |= f + p.PadRune = r + } + return s[1+sz:] + } + return s +} + +func (p *parser) parseAffix(s string) string { + x := len(p.buf) + p.buf = append(p.buf, 0) // placeholder for affix length + + s = p.parse(p.affix, s) + + n := len(p.buf) - x - 1 + if n > 0xFF { + p.setError(errAffixTooLarge) + } + p.buf[x] = uint8(n) + return s +} + +// state implements a state transition. It returns the new state. A state +// function may set an error on the parser or may simply return on an incorrect +// token and let the next phase fail. +type state func(r rune) state + +// parse repeatedly applies a state function on the given string until a +// termination condition is reached. +func (p *parser) parse(fn state, s string) (tail string) { + for i, r := range s { + p.doNotTerminate = false + if fn = fn(r); fn == nil || p.err != nil { + return s[i:] + } + p.FormatWidth++ + } + if p.doNotTerminate { + p.setError(errUnexpectedEnd) + } + return "" +} + +func (p *parser) affix(r rune) state { + switch r { + case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9', + '#', '@', '.', '*', ',', ';': + return nil + case '\'': + p.FormatWidth-- + return p.escapeFirst + case '%': + if p.DigitShift != 0 { + p.setError(errDuplicatePercentSign) + } + p.DigitShift = 2 + case '\u2030': // ‰ Per mille + if p.DigitShift != 0 { + p.setError(errDuplicatePermilleSign) + } + p.DigitShift = 3 + // TODO: handle currency somehow: ¤, ¤¤, ¤¤¤, ¤¤¤¤ + } + p.buf = append(p.buf, string(r)...) + return p.affix +} + +func (p *parser) escapeFirst(r rune) state { + switch r { + case '\'': + p.buf = append(p.buf, "\\'"...) + return p.affix + default: + p.buf = append(p.buf, '\'') + p.buf = append(p.buf, string(r)...) + } + return p.escape +} + +func (p *parser) escape(r rune) state { + switch r { + case '\'': + p.FormatWidth-- + p.buf = append(p.buf, '\'') + return p.affix + default: + p.buf = append(p.buf, string(r)...) + } + return p.escape +} + +// number parses a number. The BNF says the integer part should always have +// a '0', but that does not appear to be the case according to the rest of the +// documentation. We will allow having only '#' numbers. +func (p *parser) number(r rune) state { + switch r { + case '#': + p.groupingCount++ + p.leadingSharps++ + case '@': + p.groupingCount++ + p.leadingSharps = 0 + p.MaxFractionDigits = -1 + return p.sigDigits(r) + case ',': + if p.leadingSharps == 0 { // no leading commas + return nil + } + p.updateGrouping() + case 'E': + p.MaxIntegerDigits = uint8(p.leadingSharps) + return p.exponent + case '.': // allow ".##" etc. + p.updateGrouping() + return p.fraction + case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return p.integer(r) + default: + return nil + } + return p.number +} + +func (p *parser) integer(r rune) state { + if !('0' <= r && r <= '9') { + var next state + switch r { + case 'E': + if p.leadingSharps > 0 { + p.MaxIntegerDigits = uint8(p.leadingSharps) + p.MinIntegerDigits + } + next = p.exponent + case '.': + next = p.fraction + case ',': + next = p.integer + } + p.updateGrouping() + return next + } + p.Increment = p.Increment*10 + uint32(r-'0') + p.groupingCount++ + p.MinIntegerDigits++ + return p.integer +} + +func (p *parser) sigDigits(r rune) state { + switch r { + case '@': + p.groupingCount++ + p.MaxSignificantDigits++ + p.MinSignificantDigits++ + case '#': + return p.sigDigitsFinal(r) + case 'E': + p.updateGrouping() + return p.normalizeSigDigitsWithExponent() + default: + p.updateGrouping() + return nil + } + return p.sigDigits +} + +func (p *parser) sigDigitsFinal(r rune) state { + switch r { + case '#': + p.groupingCount++ + p.MaxSignificantDigits++ + case 'E': + p.updateGrouping() + return p.normalizeSigDigitsWithExponent() + default: + p.updateGrouping() + return nil + } + return p.sigDigitsFinal +} + +func (p *parser) normalizeSigDigitsWithExponent() state { + p.MinIntegerDigits, p.MaxIntegerDigits = 1, 1 + p.MinFractionDigits = p.MinSignificantDigits - 1 + p.MaxFractionDigits = p.MaxSignificantDigits - 1 + p.MinSignificantDigits, p.MaxSignificantDigits = 0, 0 + return p.exponent +} + +func (p *parser) fraction(r rune) state { + switch r { + case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + p.Increment = p.Increment*10 + uint32(r-'0') + p.IncrementScale++ + p.MinFractionDigits++ + p.MaxFractionDigits++ + case '#': + p.MaxFractionDigits++ + case 'E': + if p.leadingSharps > 0 { + p.MaxIntegerDigits = uint8(p.leadingSharps) + p.MinIntegerDigits + } + return p.exponent + default: + return nil + } + return p.fraction +} + +func (p *parser) exponent(r rune) state { + switch r { + case '+': + // Set mode and check it wasn't already set. + if p.Flags&AlwaysExpSign != 0 || p.MinExponentDigits > 0 { + break + } + p.Flags |= AlwaysExpSign + p.doNotTerminate = true + return p.exponent + case '0': + p.MinExponentDigits++ + return p.exponent + } + // termination condition + if p.MinExponentDigits == 0 { + p.setError(errors.New("format: need at least one digit")) + } + return nil +} diff --git a/vendor/golang.org/x/text/internal/number/roundingmode_string.go b/vendor/golang.org/x/text/internal/number/roundingmode_string.go new file mode 100644 index 0000000..bcc2247 --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/roundingmode_string.go @@ -0,0 +1,30 @@ +// Code generated by "stringer -type RoundingMode"; DO NOT EDIT. + +package number + +import "strconv" + +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[ToNearestEven-0] + _ = x[ToNearestZero-1] + _ = x[ToNearestAway-2] + _ = x[ToPositiveInf-3] + _ = x[ToNegativeInf-4] + _ = x[ToZero-5] + _ = x[AwayFromZero-6] + _ = x[numModes-7] +} + +const _RoundingMode_name = "ToNearestEvenToNearestZeroToNearestAwayToPositiveInfToNegativeInfToZeroAwayFromZeronumModes" + +var _RoundingMode_index = [...]uint8{0, 13, 26, 39, 52, 65, 71, 83, 91} + +func (i RoundingMode) String() string { + if i >= RoundingMode(len(_RoundingMode_index)-1) { + return "RoundingMode(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _RoundingMode_name[_RoundingMode_index[i]:_RoundingMode_index[i+1]] +} diff --git a/vendor/golang.org/x/text/internal/number/tables.go b/vendor/golang.org/x/text/internal/number/tables.go new file mode 100644 index 0000000..8efce81 --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/tables.go @@ -0,0 +1,1219 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package number + +import "golang.org/x/text/internal/stringset" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +var numSysData = []systemData{ // 59 elements + 0: {id: 0x0, digitSize: 0x1, zero: [4]uint8{0x30, 0x0, 0x0, 0x0}}, + 1: {id: 0x1, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9e, 0xa5, 0x90}}, + 2: {id: 0x2, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x9c, 0xb0}}, + 3: {id: 0x3, digitSize: 0x2, zero: [4]uint8{0xd9, 0xa0, 0x0, 0x0}}, + 4: {id: 0x4, digitSize: 0x2, zero: [4]uint8{0xdb, 0xb0, 0x0, 0x0}}, + 5: {id: 0x5, digitSize: 0x3, zero: [4]uint8{0xe1, 0xad, 0x90, 0x0}}, + 6: {id: 0x6, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa7, 0xa6, 0x0}}, + 7: {id: 0x7, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xb1, 0x90}}, + 8: {id: 0x8, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x81, 0xa6}}, + 9: {id: 0x9, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x84, 0xb6}}, + 10: {id: 0xa, digitSize: 0x3, zero: [4]uint8{0xea, 0xa9, 0x90, 0x0}}, + 11: {id: 0xb, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa5, 0xa6, 0x0}}, + 12: {id: 0xc, digitSize: 0x3, zero: [4]uint8{0xef, 0xbc, 0x90, 0x0}}, + 13: {id: 0xd, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xb5, 0x90}}, + 14: {id: 0xe, digitSize: 0x3, zero: [4]uint8{0xe0, 0xab, 0xa6, 0x0}}, + 15: {id: 0xf, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa9, 0xa6, 0x0}}, + 16: {id: 0x10, digitSize: 0x4, zero: [4]uint8{0xf0, 0x96, 0xad, 0x90}}, + 17: {id: 0x11, digitSize: 0x3, zero: [4]uint8{0xea, 0xa7, 0x90, 0x0}}, + 18: {id: 0x12, digitSize: 0x3, zero: [4]uint8{0xea, 0xa4, 0x80, 0x0}}, + 19: {id: 0x13, digitSize: 0x3, zero: [4]uint8{0xe1, 0x9f, 0xa0, 0x0}}, + 20: {id: 0x14, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb3, 0xa6, 0x0}}, + 21: {id: 0x15, digitSize: 0x3, zero: [4]uint8{0xe1, 0xaa, 0x80, 0x0}}, + 22: {id: 0x16, digitSize: 0x3, zero: [4]uint8{0xe1, 0xaa, 0x90, 0x0}}, + 23: {id: 0x17, digitSize: 0x3, zero: [4]uint8{0xe0, 0xbb, 0x90, 0x0}}, + 24: {id: 0x18, digitSize: 0x3, zero: [4]uint8{0xe1, 0xb1, 0x80, 0x0}}, + 25: {id: 0x19, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa5, 0x86, 0x0}}, + 26: {id: 0x1a, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0x8e}}, + 27: {id: 0x1b, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0x98}}, + 28: {id: 0x1c, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xb6}}, + 29: {id: 0x1d, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xac}}, + 30: {id: 0x1e, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xa2}}, + 31: {id: 0x1f, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb5, 0xa6, 0x0}}, + 32: {id: 0x20, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x99, 0x90}}, + 33: {id: 0x21, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa0, 0x90, 0x0}}, + 34: {id: 0x22, digitSize: 0x4, zero: [4]uint8{0xf0, 0x96, 0xa9, 0xa0}}, + 35: {id: 0x23, digitSize: 0x3, zero: [4]uint8{0xea, 0xaf, 0xb0, 0x0}}, + 36: {id: 0x24, digitSize: 0x3, zero: [4]uint8{0xe1, 0x81, 0x80, 0x0}}, + 37: {id: 0x25, digitSize: 0x3, zero: [4]uint8{0xe1, 0x82, 0x90, 0x0}}, + 38: {id: 0x26, digitSize: 0x3, zero: [4]uint8{0xea, 0xa7, 0xb0, 0x0}}, + 39: {id: 0x27, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x91, 0x90}}, + 40: {id: 0x28, digitSize: 0x2, zero: [4]uint8{0xdf, 0x80, 0x0, 0x0}}, + 41: {id: 0x29, digitSize: 0x3, zero: [4]uint8{0xe1, 0xb1, 0x90, 0x0}}, + 42: {id: 0x2a, digitSize: 0x3, zero: [4]uint8{0xe0, 0xad, 0xa6, 0x0}}, + 43: {id: 0x2b, digitSize: 0x4, zero: [4]uint8{0xf0, 0x90, 0x92, 0xa0}}, + 44: {id: 0x2c, digitSize: 0x3, zero: [4]uint8{0xea, 0xa3, 0x90, 0x0}}, + 45: {id: 0x2d, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x87, 0x90}}, + 46: {id: 0x2e, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x8b, 0xb0}}, + 47: {id: 0x2f, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb7, 0xa6, 0x0}}, + 48: {id: 0x30, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x83, 0xb0}}, + 49: {id: 0x31, digitSize: 0x3, zero: [4]uint8{0xe1, 0xae, 0xb0, 0x0}}, + 50: {id: 0x32, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x9b, 0x80}}, + 51: {id: 0x33, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa7, 0x90, 0x0}}, + 52: {id: 0x34, digitSize: 0x3, zero: [4]uint8{0xe0, 0xaf, 0xa6, 0x0}}, + 53: {id: 0x35, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb1, 0xa6, 0x0}}, + 54: {id: 0x36, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb9, 0x90, 0x0}}, + 55: {id: 0x37, digitSize: 0x3, zero: [4]uint8{0xe0, 0xbc, 0xa0, 0x0}}, + 56: {id: 0x38, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x93, 0x90}}, + 57: {id: 0x39, digitSize: 0x3, zero: [4]uint8{0xea, 0x98, 0xa0, 0x0}}, + 58: {id: 0x3a, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xa3, 0xa0}}, +} // Size: 378 bytes + +const ( + numAdlm = 0x1 + numAhom = 0x2 + numArab = 0x3 + numArabext = 0x4 + numArmn = 0x3b + numArmnlow = 0x3c + numBali = 0x5 + numBeng = 0x6 + numBhks = 0x7 + numBrah = 0x8 + numCakm = 0x9 + numCham = 0xa + numCyrl = 0x3d + numDeva = 0xb + numEthi = 0x3e + numFullwide = 0xc + numGeor = 0x3f + numGonm = 0xd + numGrek = 0x40 + numGreklow = 0x41 + numGujr = 0xe + numGuru = 0xf + numHanidays = 0x42 + numHanidec = 0x43 + numHans = 0x44 + numHansfin = 0x45 + numHant = 0x46 + numHantfin = 0x47 + numHebr = 0x48 + numHmng = 0x10 + numJava = 0x11 + numJpan = 0x49 + numJpanfin = 0x4a + numKali = 0x12 + numKhmr = 0x13 + numKnda = 0x14 + numLana = 0x15 + numLanatham = 0x16 + numLaoo = 0x17 + numLatn = 0x0 + numLepc = 0x18 + numLimb = 0x19 + numMathbold = 0x1a + numMathdbl = 0x1b + numMathmono = 0x1c + numMathsanb = 0x1d + numMathsans = 0x1e + numMlym = 0x1f + numModi = 0x20 + numMong = 0x21 + numMroo = 0x22 + numMtei = 0x23 + numMymr = 0x24 + numMymrshan = 0x25 + numMymrtlng = 0x26 + numNewa = 0x27 + numNkoo = 0x28 + numOlck = 0x29 + numOrya = 0x2a + numOsma = 0x2b + numRoman = 0x4b + numRomanlow = 0x4c + numSaur = 0x2c + numShrd = 0x2d + numSind = 0x2e + numSinh = 0x2f + numSora = 0x30 + numSund = 0x31 + numTakr = 0x32 + numTalu = 0x33 + numTaml = 0x4d + numTamldec = 0x34 + numTelu = 0x35 + numThai = 0x36 + numTibt = 0x37 + numTirh = 0x38 + numVaii = 0x39 + numWara = 0x3a + numNumberSystems +) + +var systemMap = map[string]system{ + "adlm": numAdlm, + "ahom": numAhom, + "arab": numArab, + "arabext": numArabext, + "armn": numArmn, + "armnlow": numArmnlow, + "bali": numBali, + "beng": numBeng, + "bhks": numBhks, + "brah": numBrah, + "cakm": numCakm, + "cham": numCham, + "cyrl": numCyrl, + "deva": numDeva, + "ethi": numEthi, + "fullwide": numFullwide, + "geor": numGeor, + "gonm": numGonm, + "grek": numGrek, + "greklow": numGreklow, + "gujr": numGujr, + "guru": numGuru, + "hanidays": numHanidays, + "hanidec": numHanidec, + "hans": numHans, + "hansfin": numHansfin, + "hant": numHant, + "hantfin": numHantfin, + "hebr": numHebr, + "hmng": numHmng, + "java": numJava, + "jpan": numJpan, + "jpanfin": numJpanfin, + "kali": numKali, + "khmr": numKhmr, + "knda": numKnda, + "lana": numLana, + "lanatham": numLanatham, + "laoo": numLaoo, + "latn": numLatn, + "lepc": numLepc, + "limb": numLimb, + "mathbold": numMathbold, + "mathdbl": numMathdbl, + "mathmono": numMathmono, + "mathsanb": numMathsanb, + "mathsans": numMathsans, + "mlym": numMlym, + "modi": numModi, + "mong": numMong, + "mroo": numMroo, + "mtei": numMtei, + "mymr": numMymr, + "mymrshan": numMymrshan, + "mymrtlng": numMymrtlng, + "newa": numNewa, + "nkoo": numNkoo, + "olck": numOlck, + "orya": numOrya, + "osma": numOsma, + "roman": numRoman, + "romanlow": numRomanlow, + "saur": numSaur, + "shrd": numShrd, + "sind": numSind, + "sinh": numSinh, + "sora": numSora, + "sund": numSund, + "takr": numTakr, + "talu": numTalu, + "taml": numTaml, + "tamldec": numTamldec, + "telu": numTelu, + "thai": numThai, + "tibt": numTibt, + "tirh": numTirh, + "vaii": numVaii, + "wara": numWara, +} + +var symIndex = [][12]uint8{ // 81 elements + 0: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 1: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 2: [12]uint8{0x0, 0x1, 0x2, 0xd, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb}, + 3: [12]uint8{0x1, 0x0, 0x2, 0xd, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb}, + 4: [12]uint8{0x0, 0x1, 0x2, 0x11, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb}, + 5: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x12, 0xb}, + 6: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 7: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x13, 0xb}, + 8: [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 9: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0}, + 10: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb}, + 11: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb}, + 12: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb}, + 13: [12]uint8{0x0, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 14: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x16, 0xb}, + 15: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, + 16: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0x0}, + 17: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, + 18: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0}, + 19: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x18, 0x7, 0x8, 0x9, 0xa, 0xb}, + 20: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x19, 0x1a, 0xa, 0xb}, + 21: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 22: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x7, 0x8, 0x9, 0xa, 0xb}, + 23: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 24: [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0x1c, 0x6, 0x7, 0x8, 0x9, 0x1d, 0xb}, + 25: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0x1e, 0x0}, + 26: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 27: [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 28: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x1f, 0xb}, + 29: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 30: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x20, 0xb}, + 31: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x21, 0x7, 0x8, 0x9, 0x22, 0xb}, + 32: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x23, 0xb}, + 33: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x14, 0x8, 0x9, 0x24, 0xb}, + 34: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x7, 0x8, 0x9, 0x24, 0xb}, + 35: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x25, 0xb}, + 36: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x26, 0xb}, + 37: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x27, 0xb}, + 38: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x28, 0xb}, + 39: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x29, 0xb}, + 40: [12]uint8{0x1, 0x0, 0x2, 0x3, 0xe, 0x1c, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 41: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2a, 0xb}, + 42: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2b, 0xb}, + 43: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x2c, 0x14, 0x8, 0x9, 0x24, 0xb}, + 44: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0}, + 45: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, + 46: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, + 47: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2d, 0x0}, + 48: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2e, 0xb}, + 49: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2f, 0xb}, + 50: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x30, 0x7, 0x8, 0x9, 0xa, 0xb}, + 51: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x31, 0xb}, + 52: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x32, 0xb}, + 53: [12]uint8{0x1, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 54: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x33, 0xb}, + 55: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x34, 0xb}, + 56: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 57: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0x3d, 0xb}, + 58: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 59: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 60: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x39, 0x40, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 61: [12]uint8{0x35, 0x36, 0x37, 0x41, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 62: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 63: [12]uint8{0x35, 0xc, 0x37, 0x38, 0x39, 0x42, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0x0}, + 64: [12]uint8{0x35, 0xc, 0x37, 0x38, 0x39, 0x42, 0x43, 0x7, 0x44, 0x9, 0x24, 0xb}, + 65: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x5, 0x3b, 0x7, 0x3c, 0x9, 0x33, 0xb}, + 66: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x45, 0x46, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, + 67: [12]uint8{0x35, 0x36, 0x37, 0x11, 0xe, 0x1c, 0x43, 0x7, 0x3c, 0x9, 0x1d, 0xb}, + 68: [12]uint8{0x35, 0x36, 0x37, 0x11, 0xe, 0x1c, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, + 69: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x45, 0x5, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, + 70: [12]uint8{0x1, 0xc, 0x37, 0x11, 0x45, 0x47, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x0}, + 71: [12]uint8{0x35, 0x1, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, + 72: [12]uint8{0x1, 0xc, 0x37, 0x11, 0x45, 0x47, 0x43, 0x7, 0x3c, 0x9, 0x24, 0xb}, + 73: [12]uint8{0x35, 0x36, 0x2, 0x3, 0x45, 0x46, 0x43, 0x7, 0x8, 0x9, 0xa, 0x35}, + 74: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0x31, 0x35}, + 75: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0x32, 0x35}, + 76: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x48, 0x46, 0x43, 0x7, 0x3c, 0x9, 0x33, 0x35}, + 77: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x49}, + 78: [12]uint8{0x0, 0x1, 0x4a, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x28, 0xb}, + 79: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x4b, 0xb}, + 80: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x4c, 0x4d, 0xb}, +} // Size: 996 bytes + +var symData = stringset.Set{ + Data: "" + // Size: 599 bytes + ".,;%+-E׉∞NaN:\u00a0\u200e%\u200e\u200e+\u200e-ليس\u00a0رقمًا٪NDТерхьаш" + + "\u00a0дац·’mnne×10^0/00INF−\u200e−ناعددepälukuՈչԹარ\u00a0არის\u00a0რიცხვ" + + "იZMdMсан\u00a0емес¤¤¤сан\u00a0эмесບໍ່\u200bແມ່ນ\u200bໂຕ\u200bເລກNSဂဏန်" + + "းမဟုတ်သောННне\u00a0числочыыһыла\u00a0буотах·10^epilohosan\u00a0dälTFЕs" + + "on\u00a0emasҳақиқий\u00a0сон\u00a0эмас非數值非数值٫٬؛٪\u061c\u061c+\u061c-اس؉ل" + + "يس\u00a0رقم\u200f+\u200f-\u200f−٪\u200f\u061c−×۱۰^؉\u200f\u200e+\u200e" + + "\u200e-\u200e\u200e−\u200e+\u200e：၊ཨང་མེན་གྲངས་མེདཨང་མད", + Index: []uint16{ // 79 elements + // Entry 0 - 3F + 0x0000, 0x0001, 0x0002, 0x0003, 0x0004, 0x0005, 0x0006, 0x0007, + 0x0009, 0x000c, 0x000f, 0x0012, 0x0013, 0x0015, 0x001c, 0x0020, + 0x0024, 0x0036, 0x0038, 0x003a, 0x0050, 0x0052, 0x0055, 0x0058, + 0x0059, 0x005e, 0x0062, 0x0065, 0x0068, 0x006e, 0x0078, 0x0080, + 0x0086, 0x00ae, 0x00af, 0x00b2, 0x00c2, 0x00c8, 0x00d8, 0x0105, + 0x0107, 0x012e, 0x0132, 0x0142, 0x015e, 0x0163, 0x016a, 0x0173, + 0x0175, 0x0177, 0x0180, 0x01a0, 0x01a9, 0x01b2, 0x01b4, 0x01b6, + 0x01b8, 0x01bc, 0x01bf, 0x01c2, 0x01c6, 0x01c8, 0x01d6, 0x01da, + // Entry 40 - 7F + 0x01de, 0x01e4, 0x01e9, 0x01ee, 0x01f5, 0x01fa, 0x0201, 0x0208, + 0x0211, 0x0215, 0x0218, 0x021b, 0x0230, 0x0248, 0x0257, + }, +} // Size: 797 bytes + +// langToDefaults maps a compact language index to the default numbering system +// and default symbol set +var langToDefaults = [775]symOffset{ + // Entry 0 - 3F + 0x8000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000, 0x0000, + 0x0000, 0x0000, 0x8003, 0x0002, 0x0002, 0x0002, 0x0002, 0x0003, + 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, + 0x0003, 0x0003, 0x0003, 0x0003, 0x0002, 0x0002, 0x0002, 0x0004, + 0x0002, 0x0004, 0x0002, 0x0002, 0x0002, 0x0003, 0x0002, 0x0000, + 0x8005, 0x0000, 0x0000, 0x0000, 0x8006, 0x0005, 0x0006, 0x0006, + 0x0006, 0x0006, 0x0006, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000, + // Entry 40 - 7F + 0x8009, 0x0000, 0x0000, 0x800a, 0x0000, 0x0000, 0x800c, 0x0001, + 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, + 0x0006, 0x0006, 0x0006, 0x0006, 0x800e, 0x0000, 0x0000, 0x0007, + 0x0007, 0x0000, 0x0000, 0x0000, 0x0000, 0x800f, 0x0008, 0x0008, + 0x8011, 0x0001, 0x0001, 0x0001, 0x803c, 0x0000, 0x0009, 0x0009, + 0x0009, 0x0000, 0x0000, 0x000a, 0x000b, 0x000a, 0x000c, 0x000a, + 0x000a, 0x000c, 0x000a, 0x000d, 0x000d, 0x000a, 0x000a, 0x0001, + 0x0001, 0x0000, 0x0001, 0x0001, 0x803f, 0x0000, 0x0000, 0x0000, + // Entry 80 - BF + 0x000e, 0x000e, 0x000e, 0x000f, 0x000f, 0x000f, 0x0000, 0x0000, + 0x0006, 0x0000, 0x0000, 0x0000, 0x000a, 0x0010, 0x0000, 0x0006, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0011, 0x0000, 0x000a, + 0x0000, 0x0000, 0x0000, 0x0000, 0x000a, 0x0000, 0x0009, 0x0000, + 0x0000, 0x0012, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + // Entry C0 - FF + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0013, 0x0000, + 0x0000, 0x000f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0001, 0x0000, 0x0000, 0x0015, + 0x0015, 0x0006, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000, 0x0006, + 0x0006, 0x0001, 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, + // Entry 100 - 13F + 0x0000, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, + 0x0000, 0x0006, 0x0000, 0x0000, 0x0006, 0x0006, 0x0016, 0x0016, + 0x0017, 0x0017, 0x0001, 0x0001, 0x8041, 0x0018, 0x0018, 0x0001, + 0x0001, 0x0001, 0x0001, 0x0001, 0x0019, 0x0019, 0x0000, 0x0000, + 0x0017, 0x0017, 0x0017, 0x8044, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0006, 0x0006, 0x0001, 0x0001, 0x0001, 0x0001, + // Entry 140 - 17F + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0006, 0x0006, 0x0006, 0x0006, 0x0000, 0x0000, + 0x8047, 0x0000, 0x0006, 0x0006, 0x001a, 0x001a, 0x001a, 0x001a, + 0x804a, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x804c, 0x001b, 0x0000, + 0x0000, 0x0006, 0x0006, 0x0006, 0x000a, 0x000a, 0x0001, 0x0001, + 0x001c, 0x001c, 0x0009, 0x0009, 0x804f, 0x0000, 0x0000, 0x0000, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x8052, 0x0006, 0x0006, 0x001d, 0x0006, 0x0006, + 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x001e, 0x001e, 0x001f, + 0x001f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0001, + 0x0001, 0x000d, 0x000d, 0x0000, 0x0000, 0x0020, 0x0020, 0x0006, + 0x0006, 0x0021, 0x0021, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, + 0x0000, 0x8054, 0x0000, 0x0000, 0x0000, 0x0000, 0x8056, 0x001b, + 0x0000, 0x0000, 0x0001, 0x0001, 0x0022, 0x0022, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x0000, 0x0023, 0x0023, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, + 0x0024, 0x0024, 0x8058, 0x0000, 0x0000, 0x0016, 0x0016, 0x0006, + 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0025, 0x0025, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x000d, 0x000d, 0x0000, 0x0000, + 0x0006, 0x0006, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x805a, 0x0000, 0x0000, 0x0006, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x805b, 0x0026, 0x805d, + // Entry 200 - 23F + 0x0000, 0x0000, 0x0000, 0x0000, 0x805e, 0x0015, 0x0015, 0x0000, + 0x0000, 0x0006, 0x0006, 0x0006, 0x8061, 0x0000, 0x0000, 0x8062, + 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0001, + 0x0001, 0x0015, 0x0015, 0x0006, 0x0006, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0027, 0x0027, 0x0027, 0x8065, 0x8067, + 0x001b, 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, + 0x8069, 0x0028, 0x0006, 0x0001, 0x0006, 0x0001, 0x0001, 0x0001, + // Entry 240 - 27F + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000, + 0x0006, 0x0000, 0x0000, 0x001a, 0x001a, 0x0006, 0x0006, 0x0006, + 0x0006, 0x0006, 0x0000, 0x0000, 0x0029, 0x0029, 0x0029, 0x0029, + 0x0029, 0x0029, 0x0029, 0x0006, 0x0006, 0x0000, 0x0000, 0x002a, + 0x002a, 0x0000, 0x0000, 0x0000, 0x0000, 0x806b, 0x0000, 0x0000, + 0x002b, 0x002b, 0x002b, 0x002b, 0x0006, 0x0006, 0x000d, 0x000d, + 0x0006, 0x0006, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x002c, 0x002c, 0x002d, 0x002d, 0x002e, 0x002e, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x002f, 0x002f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0006, + 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, + 0x0006, 0x0006, 0x0000, 0x0000, 0x0000, 0x806d, 0x0022, 0x0022, + 0x0022, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0030, 0x0030, 0x0000, 0x0000, 0x8071, 0x0031, 0x0006, + // Entry 2C0 - 2FF + 0x0006, 0x0006, 0x0000, 0x0001, 0x0001, 0x000d, 0x000d, 0x0001, + 0x0001, 0x0000, 0x0000, 0x0032, 0x0032, 0x8074, 0x8076, 0x001b, + 0x8077, 0x8079, 0x0028, 0x807b, 0x0034, 0x0033, 0x0033, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0035, 0x0035, 0x0006, 0x0006, + 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0036, 0x0037, 0x0037, 0x0036, 0x0036, 0x0001, + 0x0001, 0x807d, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x8080, + // Entry 300 - 33F + 0x0036, 0x0036, 0x0036, 0x0000, 0x0000, 0x0006, 0x0014, +} // Size: 1550 bytes + +// langToAlt is a list of numbering system and symbol set pairs, sorted and +// marked by compact language index. +var langToAlt = []altSymData{ // 131 elements + 1: {compactTag: 0x0, symIndex: 0x38, system: 0x3}, + 2: {compactTag: 0x0, symIndex: 0x42, system: 0x4}, + 3: {compactTag: 0xa, symIndex: 0x39, system: 0x3}, + 4: {compactTag: 0xa, symIndex: 0x2, system: 0x0}, + 5: {compactTag: 0x28, symIndex: 0x0, system: 0x6}, + 6: {compactTag: 0x2c, symIndex: 0x5, system: 0x0}, + 7: {compactTag: 0x2c, symIndex: 0x3a, system: 0x3}, + 8: {compactTag: 0x2c, symIndex: 0x42, system: 0x4}, + 9: {compactTag: 0x40, symIndex: 0x0, system: 0x6}, + 10: {compactTag: 0x43, symIndex: 0x0, system: 0x0}, + 11: {compactTag: 0x43, symIndex: 0x4f, system: 0x37}, + 12: {compactTag: 0x46, symIndex: 0x1, system: 0x0}, + 13: {compactTag: 0x46, symIndex: 0x38, system: 0x3}, + 14: {compactTag: 0x54, symIndex: 0x0, system: 0x9}, + 15: {compactTag: 0x5d, symIndex: 0x3a, system: 0x3}, + 16: {compactTag: 0x5d, symIndex: 0x8, system: 0x0}, + 17: {compactTag: 0x60, symIndex: 0x1, system: 0x0}, + 18: {compactTag: 0x60, symIndex: 0x38, system: 0x3}, + 19: {compactTag: 0x60, symIndex: 0x42, system: 0x4}, + 20: {compactTag: 0x60, symIndex: 0x0, system: 0x5}, + 21: {compactTag: 0x60, symIndex: 0x0, system: 0x6}, + 22: {compactTag: 0x60, symIndex: 0x0, system: 0x8}, + 23: {compactTag: 0x60, symIndex: 0x0, system: 0x9}, + 24: {compactTag: 0x60, symIndex: 0x0, system: 0xa}, + 25: {compactTag: 0x60, symIndex: 0x0, system: 0xb}, + 26: {compactTag: 0x60, symIndex: 0x0, system: 0xc}, + 27: {compactTag: 0x60, symIndex: 0x0, system: 0xd}, + 28: {compactTag: 0x60, symIndex: 0x0, system: 0xe}, + 29: {compactTag: 0x60, symIndex: 0x0, system: 0xf}, + 30: {compactTag: 0x60, symIndex: 0x0, system: 0x11}, + 31: {compactTag: 0x60, symIndex: 0x0, system: 0x12}, + 32: {compactTag: 0x60, symIndex: 0x0, system: 0x13}, + 33: {compactTag: 0x60, symIndex: 0x0, system: 0x14}, + 34: {compactTag: 0x60, symIndex: 0x0, system: 0x15}, + 35: {compactTag: 0x60, symIndex: 0x0, system: 0x16}, + 36: {compactTag: 0x60, symIndex: 0x0, system: 0x17}, + 37: {compactTag: 0x60, symIndex: 0x0, system: 0x18}, + 38: {compactTag: 0x60, symIndex: 0x0, system: 0x19}, + 39: {compactTag: 0x60, symIndex: 0x0, system: 0x1f}, + 40: {compactTag: 0x60, symIndex: 0x0, system: 0x21}, + 41: {compactTag: 0x60, symIndex: 0x0, system: 0x23}, + 42: {compactTag: 0x60, symIndex: 0x0, system: 0x24}, + 43: {compactTag: 0x60, symIndex: 0x0, system: 0x25}, + 44: {compactTag: 0x60, symIndex: 0x0, system: 0x28}, + 45: {compactTag: 0x60, symIndex: 0x0, system: 0x29}, + 46: {compactTag: 0x60, symIndex: 0x0, system: 0x2a}, + 47: {compactTag: 0x60, symIndex: 0x0, system: 0x2b}, + 48: {compactTag: 0x60, symIndex: 0x0, system: 0x2c}, + 49: {compactTag: 0x60, symIndex: 0x0, system: 0x2d}, + 50: {compactTag: 0x60, symIndex: 0x0, system: 0x30}, + 51: {compactTag: 0x60, symIndex: 0x0, system: 0x31}, + 52: {compactTag: 0x60, symIndex: 0x0, system: 0x32}, + 53: {compactTag: 0x60, symIndex: 0x0, system: 0x33}, + 54: {compactTag: 0x60, symIndex: 0x0, system: 0x34}, + 55: {compactTag: 0x60, symIndex: 0x0, system: 0x35}, + 56: {compactTag: 0x60, symIndex: 0x0, system: 0x36}, + 57: {compactTag: 0x60, symIndex: 0x0, system: 0x37}, + 58: {compactTag: 0x60, symIndex: 0x0, system: 0x39}, + 59: {compactTag: 0x60, symIndex: 0x0, system: 0x43}, + 60: {compactTag: 0x64, symIndex: 0x0, system: 0x0}, + 61: {compactTag: 0x64, symIndex: 0x38, system: 0x3}, + 62: {compactTag: 0x64, symIndex: 0x42, system: 0x4}, + 63: {compactTag: 0x7c, symIndex: 0x50, system: 0x37}, + 64: {compactTag: 0x7c, symIndex: 0x0, system: 0x0}, + 65: {compactTag: 0x114, symIndex: 0x43, system: 0x4}, + 66: {compactTag: 0x114, symIndex: 0x18, system: 0x0}, + 67: {compactTag: 0x114, symIndex: 0x3b, system: 0x3}, + 68: {compactTag: 0x123, symIndex: 0x1, system: 0x0}, + 69: {compactTag: 0x123, symIndex: 0x3c, system: 0x3}, + 70: {compactTag: 0x123, symIndex: 0x44, system: 0x4}, + 71: {compactTag: 0x158, symIndex: 0x0, system: 0x0}, + 72: {compactTag: 0x158, symIndex: 0x3b, system: 0x3}, + 73: {compactTag: 0x158, symIndex: 0x45, system: 0x4}, + 74: {compactTag: 0x160, symIndex: 0x0, system: 0x0}, + 75: {compactTag: 0x160, symIndex: 0x38, system: 0x3}, + 76: {compactTag: 0x16d, symIndex: 0x1b, system: 0x0}, + 77: {compactTag: 0x16d, symIndex: 0x0, system: 0x9}, + 78: {compactTag: 0x16d, symIndex: 0x0, system: 0xa}, + 79: {compactTag: 0x17c, symIndex: 0x0, system: 0x0}, + 80: {compactTag: 0x17c, symIndex: 0x3d, system: 0x3}, + 81: {compactTag: 0x17c, symIndex: 0x42, system: 0x4}, + 82: {compactTag: 0x182, symIndex: 0x6, system: 0x0}, + 83: {compactTag: 0x182, symIndex: 0x38, system: 0x3}, + 84: {compactTag: 0x1b1, symIndex: 0x0, system: 0x0}, + 85: {compactTag: 0x1b1, symIndex: 0x3e, system: 0x3}, + 86: {compactTag: 0x1b6, symIndex: 0x42, system: 0x4}, + 87: {compactTag: 0x1b6, symIndex: 0x1b, system: 0x0}, + 88: {compactTag: 0x1d2, symIndex: 0x42, system: 0x4}, + 89: {compactTag: 0x1d2, symIndex: 0x0, system: 0x0}, + 90: {compactTag: 0x1f3, symIndex: 0x0, system: 0xb}, + 91: {compactTag: 0x1fd, symIndex: 0x4e, system: 0x24}, + 92: {compactTag: 0x1fd, symIndex: 0x26, system: 0x0}, + 93: {compactTag: 0x1ff, symIndex: 0x42, system: 0x4}, + 94: {compactTag: 0x204, symIndex: 0x15, system: 0x0}, + 95: {compactTag: 0x204, symIndex: 0x3f, system: 0x3}, + 96: {compactTag: 0x204, symIndex: 0x46, system: 0x4}, + 97: {compactTag: 0x20c, symIndex: 0x0, system: 0xb}, + 98: {compactTag: 0x20f, symIndex: 0x6, system: 0x0}, + 99: {compactTag: 0x20f, symIndex: 0x38, system: 0x3}, + 100: {compactTag: 0x20f, symIndex: 0x42, system: 0x4}, + 101: {compactTag: 0x22e, symIndex: 0x0, system: 0x0}, + 102: {compactTag: 0x22e, symIndex: 0x47, system: 0x4}, + 103: {compactTag: 0x22f, symIndex: 0x42, system: 0x4}, + 104: {compactTag: 0x22f, symIndex: 0x1b, system: 0x0}, + 105: {compactTag: 0x238, symIndex: 0x42, system: 0x4}, + 106: {compactTag: 0x238, symIndex: 0x28, system: 0x0}, + 107: {compactTag: 0x265, symIndex: 0x38, system: 0x3}, + 108: {compactTag: 0x265, symIndex: 0x0, system: 0x0}, + 109: {compactTag: 0x29d, symIndex: 0x22, system: 0x0}, + 110: {compactTag: 0x29d, symIndex: 0x40, system: 0x3}, + 111: {compactTag: 0x29d, symIndex: 0x48, system: 0x4}, + 112: {compactTag: 0x29d, symIndex: 0x4d, system: 0xc}, + 113: {compactTag: 0x2bd, symIndex: 0x31, system: 0x0}, + 114: {compactTag: 0x2bd, symIndex: 0x3e, system: 0x3}, + 115: {compactTag: 0x2bd, symIndex: 0x42, system: 0x4}, + 116: {compactTag: 0x2cd, symIndex: 0x1b, system: 0x0}, + 117: {compactTag: 0x2cd, symIndex: 0x49, system: 0x4}, + 118: {compactTag: 0x2ce, symIndex: 0x49, system: 0x4}, + 119: {compactTag: 0x2d0, symIndex: 0x33, system: 0x0}, + 120: {compactTag: 0x2d0, symIndex: 0x4a, system: 0x4}, + 121: {compactTag: 0x2d1, symIndex: 0x42, system: 0x4}, + 122: {compactTag: 0x2d1, symIndex: 0x28, system: 0x0}, + 123: {compactTag: 0x2d3, symIndex: 0x34, system: 0x0}, + 124: {compactTag: 0x2d3, symIndex: 0x4b, system: 0x4}, + 125: {compactTag: 0x2f9, symIndex: 0x0, system: 0x0}, + 126: {compactTag: 0x2f9, symIndex: 0x38, system: 0x3}, + 127: {compactTag: 0x2f9, symIndex: 0x42, system: 0x4}, + 128: {compactTag: 0x2ff, symIndex: 0x36, system: 0x0}, + 129: {compactTag: 0x2ff, symIndex: 0x41, system: 0x3}, + 130: {compactTag: 0x2ff, symIndex: 0x4c, system: 0x4}, +} // Size: 810 bytes + +var tagToDecimal = []uint8{ // 775 elements + // Entry 0 - 3F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 40 - 7F + 0x05, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x05, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x01, 0x01, + // Entry 80 - BF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry C0 - FF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 100 - 13F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 140 - 17F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, + 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 180 - 1BF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x05, 0x05, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 1C0 - 1FF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, + 0x01, 0x01, 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 200 - 23F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x05, 0x01, + 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 240 - 27F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 280 - 2BF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, + 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 2C0 - 2FF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 300 - 33F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x08, +} // Size: 799 bytes + +var tagToScientific = []uint8{ // 775 elements + // Entry 0 - 3F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 40 - 7F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 80 - BF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry C0 - FF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 100 - 13F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 140 - 17F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x0c, + 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 180 - 1BF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 1C0 - 1FF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x0d, 0x0d, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x0c, 0x0c, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 200 - 23F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x0c, 0x02, + 0x02, 0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 240 - 27F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x0d, 0x0d, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 280 - 2BF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 2C0 - 2FF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 300 - 33F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x09, +} // Size: 799 bytes + +var tagToPercent = []uint8{ // 775 elements + // Entry 0 - 3F + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x04, 0x04, 0x04, 0x03, 0x03, + 0x06, 0x06, 0x03, 0x04, 0x04, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x06, 0x06, 0x06, 0x03, + 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, + 0x03, 0x04, 0x04, 0x03, 0x03, 0x03, 0x04, 0x03, + 0x03, 0x04, 0x03, 0x04, 0x04, 0x03, 0x03, 0x03, + 0x03, 0x04, 0x04, 0x04, 0x07, 0x07, 0x04, 0x04, + // Entry 80 - BF + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x03, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x03, 0x04, 0x03, 0x04, + 0x04, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry C0 - FF + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + // Entry 100 - 13F + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x04, 0x04, + 0x0b, 0x0b, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x04, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + // Entry 140 - 17F + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x06, + 0x06, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 180 - 1BF + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04, + // Entry 1C0 - 1FF + 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 200 - 23F + 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x06, 0x06, 0x04, 0x04, 0x04, 0x06, 0x04, + 0x04, 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 240 - 27F + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x03, 0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x04, 0x04, + // Entry 280 - 2BF + 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, + 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x06, + 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x0e, + // Entry 2C0 - 2FF + 0x0e, 0x0e, 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, + 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 300 - 33F + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x0a, +} // Size: 799 bytes + +var formats = []Pattern{Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x0, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x0, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 3, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x9, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x0, + MaxIntegerDigits: 0x1, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x1}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x3, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x03\u00a0%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x7, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x01%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x6, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 3, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0xc, + GroupingSize: [2]uint8{0x3, + 0x2}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x01%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x9, + GroupingSize: [2]uint8{0x3, + 0x2}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x03\u00a0%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0xa, + GroupingSize: [2]uint8{0x3, + 0x2}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 6, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x8, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 6, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x6, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x3}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0xd, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x4}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x01%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x2, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x03%\u00a0\x00", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x7, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x0, + MaxIntegerDigits: 0x1, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x1}, + Affix: "\x01[\x01]", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x5, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x0, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x1, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x01%\x00", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x6, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}} + +// Total table size 8634 bytes (8KiB); checksum: 8F23386D diff --git a/vendor/golang.org/x/text/internal/stringset/set.go b/vendor/golang.org/x/text/internal/stringset/set.go new file mode 100644 index 0000000..bb2fffb --- /dev/null +++ b/vendor/golang.org/x/text/internal/stringset/set.go @@ -0,0 +1,86 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package stringset provides a way to represent a collection of strings +// compactly. +package stringset + +import "sort" + +// A Set holds a collection of strings that can be looked up by an index number. +type Set struct { + // These fields are exported to allow for code generation. + + Data string + Index []uint16 +} + +// Elem returns the string with index i. It panics if i is out of range. +func (s *Set) Elem(i int) string { + return s.Data[s.Index[i]:s.Index[i+1]] +} + +// Len returns the number of strings in the set. +func (s *Set) Len() int { + return len(s.Index) - 1 +} + +// Search returns the index of the given string or -1 if it is not in the set. +// The Set must have been created with strings in sorted order. +func Search(s *Set, str string) int { + // TODO: optimize this if it gets used a lot. + n := len(s.Index) - 1 + p := sort.Search(n, func(i int) bool { + return s.Elem(i) >= str + }) + if p == n || str != s.Elem(p) { + return -1 + } + return p +} + +// A Builder constructs Sets. +type Builder struct { + set Set + index map[string]int +} + +// NewBuilder returns a new and initialized Builder. +func NewBuilder() *Builder { + return &Builder{ + set: Set{ + Index: []uint16{0}, + }, + index: map[string]int{}, + } +} + +// Set creates the set created so far. +func (b *Builder) Set() Set { + return b.set +} + +// Index returns the index for the given string, which must have been added +// before. +func (b *Builder) Index(s string) int { + return b.index[s] +} + +// Add adds a string to the index. Strings that are added by a single Add will +// be stored together, unless they match an existing string. +func (b *Builder) Add(ss ...string) { + // First check if the string already exists. + for _, s := range ss { + if _, ok := b.index[s]; ok { + continue + } + b.index[s] = len(b.set.Index) - 1 + b.set.Data += s + x := len(b.set.Data) + if x > 0xFFFF { + panic("Index too > 0xFFFF") + } + b.set.Index = append(b.set.Index, uint16(x)) + } +} diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go new file mode 100644 index 0000000..b5d3488 --- /dev/null +++ b/vendor/golang.org/x/text/internal/tag/tag.go @@ -0,0 +1,100 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package tag contains functionality handling tags and related data. +package tag // import "golang.org/x/text/internal/tag" + +import "sort" + +// An Index converts tags to a compact numeric value. +// +// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can +// be used to store additional information about the tag. +type Index string + +// Elem returns the element data at the given index. +func (s Index) Elem(x int) string { + return string(s[x*4 : x*4+4]) +} + +// Index reports the index of the given key or -1 if it could not be found. +// Only the first len(key) bytes from the start of the 4-byte entries will be +// considered for the search and the first match in Index will be returned. +func (s Index) Index(key []byte) int { + n := len(key) + // search the index of the first entry with an equal or higher value than + // key in s. + index := sort.Search(len(s)/4, func(i int) bool { + return cmp(s[i*4:i*4+n], key) != -1 + }) + i := index * 4 + if cmp(s[i:i+len(key)], key) != 0 { + return -1 + } + return index +} + +// Next finds the next occurrence of key after index x, which must have been +// obtained from a call to Index using the same key. It returns x+1 or -1. +func (s Index) Next(key []byte, x int) int { + if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { + return x + } + return -1 +} + +// cmp returns an integer comparing a and b lexicographically. +func cmp(a Index, b []byte) int { + n := len(a) + if len(b) < n { + n = len(b) + } + for i, c := range b[:n] { + switch { + case a[i] > c: + return 1 + case a[i] < c: + return -1 + } + } + switch { + case len(a) < len(b): + return -1 + case len(a) > len(b): + return 1 + } + return 0 +} + +// Compare returns an integer comparing a and b lexicographically. +func Compare(a string, b []byte) int { + return cmp(Index(a), b) +} + +// FixCase reformats b to the same pattern of cases as form. +// If returns false if string b is malformed. +func FixCase(form string, b []byte) bool { + if len(form) != len(b) { + return false + } + for i, c := range b { + if form[i] <= 'Z' { + if c >= 'a' { + c -= 'z' - 'Z' + } + if c < 'A' || 'Z' < c { + return false + } + } else { + if c <= 'Z' { + c += 'z' - 'Z' + } + if c < 'a' || 'z' < c { + return false + } + } + b[i] = c + } + return true +} diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go new file mode 100644 index 0000000..a24fd1a --- /dev/null +++ b/vendor/golang.org/x/text/language/coverage.go @@ -0,0 +1,187 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "fmt" + "sort" + + "golang.org/x/text/internal/language" +) + +// The Coverage interface is used to define the level of coverage of an +// internationalization service. Note that not all types are supported by all +// services. As lists may be generated on the fly, it is recommended that users +// of a Coverage cache the results. +type Coverage interface { + // Tags returns the list of supported tags. + Tags() []Tag + + // BaseLanguages returns the list of supported base languages. + BaseLanguages() []Base + + // Scripts returns the list of supported scripts. + Scripts() []Script + + // Regions returns the list of supported regions. + Regions() []Region +} + +var ( + // Supported defines a Coverage that lists all supported subtags. Tags + // always returns nil. + Supported Coverage = allSubtags{} +) + +// TODO: +// - Support Variants, numbering systems. +// - CLDR coverage levels. +// - Set of common tags defined in this package. + +type allSubtags struct{} + +// Regions returns the list of supported regions. As all regions are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" region is not returned. +func (s allSubtags) Regions() []Region { + reg := make([]Region, language.NumRegions) + for i := range reg { + reg[i] = Region{language.Region(i + 1)} + } + return reg +} + +// Scripts returns the list of supported scripts. As all scripts are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" script is not returned. +func (s allSubtags) Scripts() []Script { + scr := make([]Script, language.NumScripts) + for i := range scr { + scr[i] = Script{language.Script(i + 1)} + } + return scr +} + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func (s allSubtags) BaseLanguages() []Base { + bs := language.BaseLanguages() + base := make([]Base, len(bs)) + for i, b := range bs { + base[i] = Base{b} + } + return base +} + +// Tags always returns nil. +func (s allSubtags) Tags() []Tag { + return nil +} + +// coverage is used by NewCoverage which is used as a convenient way for +// creating Coverage implementations for partially defined data. Very often a +// package will only need to define a subset of slices. coverage provides a +// convenient way to do this. Moreover, packages using NewCoverage, instead of +// their own implementation, will not break if later new slice types are added. +type coverage struct { + tags func() []Tag + bases func() []Base + scripts func() []Script + regions func() []Region +} + +func (s *coverage) Tags() []Tag { + if s.tags == nil { + return nil + } + return s.tags() +} + +// bases implements sort.Interface and is used to sort base languages. +type bases []Base + +func (b bases) Len() int { + return len(b) +} + +func (b bases) Swap(i, j int) { + b[i], b[j] = b[j], b[i] +} + +func (b bases) Less(i, j int) bool { + return b[i].langID < b[j].langID +} + +// BaseLanguages returns the result from calling s.bases if it is specified or +// otherwise derives the set of supported base languages from tags. +func (s *coverage) BaseLanguages() []Base { + if s.bases == nil { + tags := s.Tags() + if len(tags) == 0 { + return nil + } + a := make([]Base, len(tags)) + for i, t := range tags { + a[i] = Base{language.Language(t.lang())} + } + sort.Sort(bases(a)) + k := 0 + for i := 1; i < len(a); i++ { + if a[k] != a[i] { + k++ + a[k] = a[i] + } + } + return a[:k+1] + } + return s.bases() +} + +func (s *coverage) Scripts() []Script { + if s.scripts == nil { + return nil + } + return s.scripts() +} + +func (s *coverage) Regions() []Region { + if s.regions == nil { + return nil + } + return s.regions() +} + +// NewCoverage returns a Coverage for the given lists. It is typically used by +// packages providing internationalization services to define their level of +// coverage. A list may be of type []T or func() []T, where T is either Tag, +// Base, Script or Region. The returned Coverage derives the value for Bases +// from Tags if no func or slice for []Base is specified. For other unspecified +// types the returned Coverage will return nil for the respective methods. +func NewCoverage(list ...interface{}) Coverage { + s := &coverage{} + for _, x := range list { + switch v := x.(type) { + case func() []Base: + s.bases = v + case func() []Script: + s.scripts = v + case func() []Region: + s.regions = v + case func() []Tag: + s.tags = v + case []Base: + s.bases = func() []Base { return v } + case []Script: + s.scripts = func() []Script { return v } + case []Region: + s.regions = func() []Region { return v } + case []Tag: + s.tags = func() []Tag { return v } + default: + panic(fmt.Sprintf("language: unsupported set type %T", v)) + } + } + return s +} diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go new file mode 100644 index 0000000..212b77c --- /dev/null +++ b/vendor/golang.org/x/text/language/doc.go @@ -0,0 +1,98 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package language implements BCP 47 language tags and related functionality. +// +// The most important function of package language is to match a list of +// user-preferred languages to a list of supported languages. +// It alleviates the developer of dealing with the complexity of this process +// and provides the user with the best experience +// (see https://blog.golang.org/matchlang). +// +// # Matching preferred against supported languages +// +// A Matcher for an application that supports English, Australian English, +// Danish, and standard Mandarin can be created as follows: +// +// var matcher = language.NewMatcher([]language.Tag{ +// language.English, // The first language is used as fallback. +// language.MustParse("en-AU"), +// language.Danish, +// language.Chinese, +// }) +// +// This list of supported languages is typically implied by the languages for +// which there exists translations of the user interface. +// +// User-preferred languages usually come as a comma-separated list of BCP 47 +// language tags. +// The MatchString finds best matches for such strings: +// +// handler(w http.ResponseWriter, r *http.Request) { +// lang, _ := r.Cookie("lang") +// accept := r.Header.Get("Accept-Language") +// tag, _ := language.MatchStrings(matcher, lang.String(), accept) +// +// // tag should now be used for the initialization of any +// // locale-specific service. +// } +// +// The Matcher's Match method can be used to match Tags directly. +// +// Matchers are aware of the intricacies of equivalence between languages, such +// as deprecated subtags, legacy tags, macro languages, mutual +// intelligibility between scripts and languages, and transparently passing +// BCP 47 user configuration. +// For instance, it will know that a reader of Bokmål Danish can read Norwegian +// and will know that Cantonese ("yue") is a good match for "zh-HK". +// +// # Using match results +// +// To guarantee a consistent user experience to the user it is important to +// use the same language tag for the selection of any locale-specific services. +// For example, it is utterly confusing to substitute spelled-out numbers +// or dates in one language in text of another language. +// More subtly confusing is using the wrong sorting order or casing +// algorithm for a certain language. +// +// All the packages in x/text that provide locale-specific services +// (e.g. collate, cases) should be initialized with the tag that was +// obtained at the start of an interaction with the user. +// +// Note that Tag that is returned by Match and MatchString may differ from any +// of the supported languages, as it may contain carried over settings from +// the user tags. +// This may be inconvenient when your application has some additional +// locale-specific data for your supported languages. +// Match and MatchString both return the index of the matched supported tag +// to simplify associating such data with the matched tag. +// +// # Canonicalization +// +// If one uses the Matcher to compare languages one does not need to +// worry about canonicalization. +// +// The meaning of a Tag varies per application. The language package +// therefore delays canonicalization and preserves information as much +// as possible. The Matcher, however, will always take into account that +// two different tags may represent the same language. +// +// By default, only legacy and deprecated tags are converted into their +// canonical equivalent. All other information is preserved. This approach makes +// the confidence scores more accurate and allows matchers to distinguish +// between variants that are otherwise lost. +// +// As a consequence, two tags that should be treated as identical according to +// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The +// Matcher handles such distinctions, though, and is aware of the +// equivalence relations. The CanonType type can be used to alter the +// canonicalization form. +// +// # References +// +// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 +package language // import "golang.org/x/text/language" + +// TODO: explanation on how to match languages for your own locale-specific +// service. diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go new file mode 100644 index 0000000..4d9c661 --- /dev/null +++ b/vendor/golang.org/x/text/language/language.go @@ -0,0 +1,605 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go -output tables.go + +package language + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag compact.Tag + +func makeTag(t language.Tag) (tag Tag) { + return Tag(compact.Make(t)) +} + +func (t *Tag) tag() language.Tag { + return (*compact.Tag)(t).Tag() +} + +func (t *Tag) isCompact() bool { + return (*compact.Tag)(t).IsCompact() +} + +// TODO: improve performance. +func (t *Tag) lang() language.Language { return t.tag().LangID } +func (t *Tag) region() language.Region { return t.tag().RegionID } +func (t *Tag) script() language.Script { return t.tag().ScriptID } + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + return Default.Make(s) +} + +// Make is a convenience wrapper for c.Parse that omits the error. +// In case of an error, a sensible default is returned. +func (c CanonType) Make(s string) Tag { + t, _ := c.Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +func (t Tag) Raw() (b Base, s Script, r Region) { + tt := t.tag() + return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID} +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + return compact.Tag(t).IsRoot() +} + +// CanonType can be used to enable or disable various types of canonicalization. +type CanonType int + +const ( + // Replace deprecated base languages with their preferred replacements. + DeprecatedBase CanonType = 1 << iota + // Replace deprecated scripts with their preferred replacements. + DeprecatedScript + // Replace deprecated regions with their preferred replacements. + DeprecatedRegion + // Remove redundant scripts. + SuppressScript + // Normalize legacy encodings. This includes legacy languages defined in + // CLDR as well as bibliographic codes defined in ISO-639. + Legacy + // Map the dominant language of a macro language group to the macro language + // subtag. For example cmn -> zh. + Macro + // The CLDR flag should be used if full compatibility with CLDR is required. + // There are a few cases where language.Tag may differ from CLDR. To follow all + // of CLDR's suggestions, use All|CLDR. + CLDR + + // Raw can be used to Compose or Parse without Canonicalization. + Raw CanonType = 0 + + // Replace all deprecated tags with their preferred replacements. + Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion + + // All canonicalizations recommended by BCP 47. + BCP47 = Deprecated | SuppressScript + + // All canonicalizations. + All = BCP47 | Legacy | Macro + + // Default is the canonicalization used by Parse, Make and Compose. To + // preserve as much information as possible, canonicalizations that remove + // potentially valuable information are not included. The Matcher is + // designed to recognize similar tags that would be the same if + // they were canonicalized using All. + Default = Deprecated | Legacy + + canonLang = DeprecatedBase | Legacy | Macro + + // TODO: LikelyScript, LikelyRegion: suppress similar to ICU. +) + +// canonicalize returns the canonicalized equivalent of the tag and +// whether there was any change. +func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) { + if c == Raw { + return t, false + } + changed := false + if c&SuppressScript != 0 { + if t.LangID.SuppressScript() == t.ScriptID { + t.ScriptID = 0 + changed = true + } + } + if c&canonLang != 0 { + for { + if l, aliasType := t.LangID.Canonicalize(); l != t.LangID { + switch aliasType { + case language.Legacy: + if c&Legacy != 0 { + if t.LangID == _sh && t.ScriptID == 0 { + t.ScriptID = _Latn + } + t.LangID = l + changed = true + } + case language.Macro: + if c&Macro != 0 { + // We deviate here from CLDR. The mapping "nb" -> "no" + // qualifies as a typical Macro language mapping. However, + // for legacy reasons, CLDR maps "no", the macro language + // code for Norwegian, to the dominant variant "nb". This + // change is currently under consideration for CLDR as well. + // See https://unicode.org/cldr/trac/ticket/2698 and also + // https://unicode.org/cldr/trac/ticket/1790 for some of the + // practical implications. TODO: this check could be removed + // if CLDR adopts this change. + if c&CLDR == 0 || t.LangID != _nb { + changed = true + t.LangID = l + } + } + case language.Deprecated: + if c&DeprecatedBase != 0 { + if t.LangID == _mo && t.RegionID == 0 { + t.RegionID = _MD + } + t.LangID = l + changed = true + // Other canonicalization types may still apply. + continue + } + } + } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 { + t.LangID = _nb + changed = true + } + break + } + } + if c&DeprecatedScript != 0 { + if t.ScriptID == _Qaai { + changed = true + t.ScriptID = _Zinh + } + } + if c&DeprecatedRegion != 0 { + if r := t.RegionID.Canonicalize(); r != t.RegionID { + changed = true + t.RegionID = r + } + } + return t, changed +} + +// Canonicalize returns the canonicalized equivalent of the tag. +func (c CanonType) Canonicalize(t Tag) (Tag, error) { + // First try fast path. + if t.isCompact() { + if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed { + return t, nil + } + } + // It is unlikely that one will canonicalize a tag after matching. So do + // a slow but simple approach here. + if tag, changed := canonicalize(c, t.tag()); changed { + tag.RemakeString() + return makeTag(tag), nil + } + return t, nil + +} + +// Confidence indicates the level of certainty for a given return value. +// For example, Serbian may be written in Cyrillic or Latin script. +// The confidence level indicates whether a value was explicitly specified, +// whether it is typically the only possible value, or whether there is +// an ambiguity. +type Confidence int + +const ( + No Confidence = iota // full confidence that there was no match + Low // most likely value picked out of a set of alternatives + High // value is generally assumed to be the correct match + Exact // exact match or explicitly specified value +) + +var confName = []string{"No", "Low", "High", "Exact"} + +func (c Confidence) String() string { + return confName[c] +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + return t.tag().String() +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + return t.tag().MarshalText() +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + var tag language.Tag + err := tag.UnmarshalText(text) + *t = makeTag(tag) + return err +} + +// Base returns the base language of the language tag. If the base language is +// unspecified, an attempt will be made to infer it from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Base() (Base, Confidence) { + if b := t.lang(); b != 0 { + return Base{b}, Exact + } + tt := t.tag() + c := High + if tt.ScriptID == 0 && !tt.RegionID.IsCountry() { + c = Low + } + if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 { + return Base{tag.LangID}, c + } + return Base{0}, No +} + +// Script infers the script for the language tag. If it was not explicitly given, it will infer +// a most likely candidate. +// If more than one script is commonly used for a language, the most likely one +// is returned with a low confidence indication. For example, it returns (Cyrl, Low) +// for Serbian. +// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) +// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks +// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. +// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for +// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. +// Note that an inferred script is never guaranteed to be the correct one. Latin is +// almost exclusively used for Afrikaans, but Arabic has been used for some texts +// in the past. Also, the script that is commonly used may change over time. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Script() (Script, Confidence) { + if scr := t.script(); scr != 0 { + return Script{scr}, Exact + } + tt := t.tag() + sc, c := language.Script(_Zzzz), No + if scr := tt.LangID.SuppressScript(); scr != 0 { + // Note: it is not always the case that a language with a suppress + // script value is only written in one script (e.g. kk, ms, pa). + if tt.RegionID == 0 { + return Script{scr}, High + } + sc, c = scr, High + } + if tag, err := tt.Maximize(); err == nil { + if tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } else { + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } + return Script{sc}, c +} + +// Region returns the region for the language tag. If it was not explicitly given, it will +// infer a most likely candidate from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Region() (Region, Confidence) { + if r := t.region(); r != 0 { + return Region{r}, Exact + } + tt := t.tag() + if tt, err := tt.Maximize(); err == nil { + return Region{tt.RegionID}, Low // TODO: differentiate between high and low. + } + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil { + return Region{tag.RegionID}, Low + } + return Region{_ZZ}, No // TODO: return world instead of undetermined? +} + +// Variants returns the variants specified explicitly for this language tag. +// or nil if no variant was specified. +func (t Tag) Variants() []Variant { + if !compact.Tag(t).MayHaveVariants() { + return nil + } + v := []Variant{} + x, str := "", t.tag().Variants() + for str != "" { + x, str = nextToken(str) + v = append(v, Variant{x}) + } + return v +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +// +// Parent returns a tag for a less specific language that is mutually +// intelligible or Und if there is no such language. This may not be the same as +// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW" +// is "zh-Hant", and the parent of "zh-Hant" is "und". +func (t Tag) Parent() Tag { + return Tag(compact.Tag(t).Parent()) +} + +// nextToken returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// Extension is a single BCP 47 extension. +type Extension struct { + s string +} + +// String returns the string representation of the extension, including the +// type tag. +func (e Extension) String() string { + return e.s +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (e Extension, err error) { + ext, err := language.ParseExtension(s) + return Extension{ext}, err +} + +// Type returns the one-byte extension type of e. It returns 0 for the zero +// exception. +func (e Extension) Type() byte { + if e.s == "" { + return 0 + } + return e.s[0] +} + +// Tokens returns the list of tokens of e. +func (e Extension) Tokens() []string { + return strings.Split(e.s, "-") +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext Extension, ok bool) { + if !compact.Tag(t).MayHaveExtensions() { + return Extension{}, false + } + e, ok := t.tag().Extension(x) + return Extension{e}, ok +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []Extension { + if !compact.Tag(t).MayHaveExtensions() { + return nil + } + e := []Extension{} + for _, ext := range t.tag().Extensions() { + e = append(e, Extension{ext}) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if !compact.Tag(t).MayHaveExtensions() { + if key != "rg" && key != "va" { + return "" + } + } + return t.tag().TypeForKey(key) +} + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + tt, err := t.tag().SetTypeForKey(key, value) + return makeTag(tt), err +} + +// NumCompactTags is the number of compact tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = compact.NumCompactTags + +// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func CompactIndex(t Tag) (index int, exact bool) { + id, exact := compact.LanguageID(compact.Tag(t)) + return int(id), exact +} + +var root = language.Tag{} + +// Base is an ISO 639 language code, used for encoding the base language +// of a language tag. +type Base struct { + langID language.Language +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Base, error) { + l, err := language.ParseBase(s) + return Base{l}, err +} + +// String returns the BCP 47 representation of the base language. +func (b Base) String() string { + return b.langID.String() +} + +// ISO3 returns the ISO 639-3 language code. +func (b Base) ISO3() string { + return b.langID.ISO3() +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Base) IsPrivateUse() bool { + return b.langID.IsPrivateUse() +} + +// Script is a 4-letter ISO 15924 code for representing scripts. +// It is idiomatically represented in title case. +type Script struct { + scriptID language.Script +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + sc, err := language.ParseScript(s) + return Script{sc}, err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + return s.scriptID.String() +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return s.scriptID.IsPrivateUse() +} + +// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. +type Region struct { + regionID language.Region +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + rid, err := language.EncodeM49(r) + return Region{rid}, err +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + r, err := language.ParseRegion(s) + return Region{r}, err +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + return r.regionID.String() +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + return r.regionID.ISO3() +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return r.regionID.M49() +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.regionID.IsPrivateUse() +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + return r.regionID.IsCountry() +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + return r.regionID.IsGroup() +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + return r.regionID.Contains(c.regionID) +} + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + tld, err := r.regionID.TLD() + return Region{tld}, err +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + return Region{r.regionID.Canonicalize()} +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + variant string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + v, err := language.ParseVariant(s) + return Variant{v.String()}, err +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.variant +} diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go new file mode 100644 index 0000000..1153baf --- /dev/null +++ b/vendor/golang.org/x/text/language/match.go @@ -0,0 +1,735 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "strings" + + "golang.org/x/text/internal/language" +) + +// A MatchOption configures a Matcher. +type MatchOption func(*matcher) + +// PreferSameScript will, in the absence of a match, result in the first +// preferred tag with the same script as a supported tag to match this supported +// tag. The default is currently true, but this may change in the future. +func PreferSameScript(preferSame bool) MatchOption { + return func(m *matcher) { m.preferSameScript = preferSame } +} + +// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface. +// There doesn't seem to be too much need for multiple types. +// Making it a concrete type allows MatchStrings to be a method, which will +// improve its discoverability. + +// MatchStrings parses and matches the given strings until one of them matches +// the language in the Matcher. A string may be an Accept-Language header as +// handled by ParseAcceptLanguage. The default language is returned if no +// other language matched. +func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) { + for _, accept := range lang { + desired, _, err := ParseAcceptLanguage(accept) + if err != nil { + continue + } + if tag, index, conf := m.Match(desired...); conf != No { + return tag, index + } + } + tag, index, _ = m.Match() + return +} + +// Matcher is the interface that wraps the Match method. +// +// Match returns the best match for any of the given tags, along with +// a unique index associated with the returned tag and a confidence +// score. +type Matcher interface { + Match(t ...Tag) (tag Tag, index int, c Confidence) +} + +// Comprehends reports the confidence score for a speaker of a given language +// to being able to comprehend the written form of an alternative language. +func Comprehends(speaker, alternative Tag) Confidence { + _, _, c := NewMatcher([]Tag{alternative}).Match(speaker) + return c +} + +// NewMatcher returns a Matcher that matches an ordered list of preferred tags +// against a list of supported tags based on written intelligibility, closeness +// of dialect, equivalence of subtags and various other rules. It is initialized +// with the list of supported tags. The first element is used as the default +// value in case no match is found. +// +// Its Match method matches the first of the given Tags to reach a certain +// confidence threshold. The tags passed to Match should therefore be specified +// in order of preference. Extensions are ignored for matching. +// +// The index returned by the Match method corresponds to the index of the +// matched tag in t, but is augmented with the Unicode extension ('u')of the +// corresponding preferred tag. This allows user locale options to be passed +// transparently. +func NewMatcher(t []Tag, options ...MatchOption) Matcher { + return newMatcher(t, options) +} + +func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { + var tt language.Tag + match, w, c := m.getBest(want...) + if match != nil { + tt, index = match.tag, match.index + } else { + // TODO: this should be an option + tt = m.default_.tag + if m.preferSameScript { + outer: + for _, w := range want { + script, _ := w.Script() + if script.scriptID == 0 { + // Don't do anything if there is no script, such as with + // private subtags. + continue + } + for i, h := range m.supported { + if script.scriptID == h.maxScript { + tt, index = h.tag, i + break outer + } + } + } + } + // TODO: select first language tag based on script. + } + if w.RegionID != tt.RegionID && w.RegionID != 0 { + if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) { + tt.RegionID = w.RegionID + tt.RemakeString() + } else if r := w.RegionID.String(); len(r) == 2 { + // TODO: also filter macro and deprecated. + tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz") + } + } + // Copy options from the user-provided tag into the result tag. This is hard + // to do after the fact, so we do it here. + // TODO: add in alternative variants to -u-va-. + // TODO: add preferred region to -u-rg-. + if e := w.Extensions(); len(e) > 0 { + b := language.Builder{} + b.SetTag(tt) + for _, e := range e { + b.AddExt(e) + } + tt = b.Make() + } + return makeTag(tt), index, c +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// func (t *Tag) setTagsFrom(id Tag) { +// t.LangID = id.LangID +// t.ScriptID = id.ScriptID +// t.RegionID = id.RegionID +// } + +// Tag Matching +// CLDR defines an algorithm for finding the best match between two sets of language +// tags. The basic algorithm defines how to score a possible match and then find +// the match with the best score +// (see https://www.unicode.org/reports/tr35/#LanguageMatching). +// Using scoring has several disadvantages. The scoring obfuscates the importance of +// the various factors considered, making the algorithm harder to understand. Using +// scoring also requires the full score to be computed for each pair of tags. +// +// We will use a different algorithm which aims to have the following properties: +// - clarity on the precedence of the various selection factors, and +// - improved performance by allowing early termination of a comparison. +// +// Matching algorithm (overview) +// Input: +// - supported: a set of supported tags +// - default: the default tag to return in case there is no match +// - desired: list of desired tags, ordered by preference, starting with +// the most-preferred. +// +// Algorithm: +// 1) Set the best match to the lowest confidence level +// 2) For each tag in "desired": +// a) For each tag in "supported": +// 1) compute the match between the two tags. +// 2) if the match is better than the previous best match, replace it +// with the new match. (see next section) +// b) if the current best match is Exact and pin is true the result will be +// frozen to the language found thusfar, although better matches may +// still be found for the same language. +// 3) If the best match so far is below a certain threshold, return "default". +// +// Ranking: +// We use two phases to determine whether one pair of tags are a better match +// than another pair of tags. First, we determine a rough confidence level. If the +// levels are different, the one with the highest confidence wins. +// Second, if the rough confidence levels are identical, we use a set of tie-breaker +// rules. +// +// The confidence level of matching a pair of tags is determined by finding the +// lowest confidence level of any matches of the corresponding subtags (the +// result is deemed as good as its weakest link). +// We define the following levels: +// Exact - An exact match of a subtag, before adding likely subtags. +// MaxExact - An exact match of a subtag, after adding likely subtags. +// [See Note 2]. +// High - High level of mutual intelligibility between different subtag +// variants. +// Low - Low level of mutual intelligibility between different subtag +// variants. +// No - No mutual intelligibility. +// +// The following levels can occur for each type of subtag: +// Base: Exact, MaxExact, High, Low, No +// Script: Exact, MaxExact [see Note 3], Low, No +// Region: Exact, MaxExact, High +// Variant: Exact, High +// Private: Exact, No +// +// Any result with a confidence level of Low or higher is deemed a possible match. +// Once a desired tag matches any of the supported tags with a level of MaxExact +// or higher, the next desired tag is not considered (see Step 2.b). +// Note that CLDR provides languageMatching data that defines close equivalence +// classes for base languages, scripts and regions. +// +// Tie-breaking +// If we get the same confidence level for two matches, we apply a sequence of +// tie-breaking rules. The first that succeeds defines the result. The rules are +// applied in the following order. +// 1) Original language was defined and was identical. +// 2) Original region was defined and was identical. +// 3) Distance between two maximized regions was the smallest. +// 4) Original script was defined and was identical. +// 5) Distance from want tag to have tag using the parent relation [see Note 5.] +// If there is still no winner after these rules are applied, the first match +// found wins. +// +// Notes: +// [2] In practice, as matching of Exact is done in a separate phase from +// matching the other levels, we reuse the Exact level to mean MaxExact in +// the second phase. As a consequence, we only need the levels defined by +// the Confidence type. The MaxExact confidence level is mapped to High in +// the public API. +// [3] We do not differentiate between maximized script values that were derived +// from suppressScript versus most likely tag data. We determined that in +// ranking the two, one ranks just after the other. Moreover, the two cannot +// occur concurrently. As a consequence, they are identical for practical +// purposes. +// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign +// the MaxExact level to allow iw vs he to still be a closer match than +// en-AU vs en-US, for example. +// [5] In CLDR a locale inherits fields that are unspecified for this locale +// from its parent. Therefore, if a locale is a parent of another locale, +// it is a strong measure for closeness, especially when no other tie +// breaker rule applies. One could also argue it is inconsistent, for +// example, when pt-AO matches pt (which CLDR equates with pt-BR), even +// though its parent is pt-PT according to the inheritance rules. +// +// Implementation Details: +// There are several performance considerations worth pointing out. Most notably, +// we preprocess as much as possible (within reason) at the time of creation of a +// matcher. This includes: +// - creating a per-language map, which includes data for the raw base language +// and its canonicalized variant (if applicable), +// - expanding entries for the equivalence classes defined in CLDR's +// languageMatch data. +// The per-language map ensures that typically only a very small number of tags +// need to be considered. The pre-expansion of canonicalized subtags and +// equivalence classes reduces the amount of map lookups that need to be done at +// runtime. + +// matcher keeps a set of supported language tags, indexed by language. +type matcher struct { + default_ *haveTag + supported []*haveTag + index map[language.Language]*matchHeader + passSettings bool + preferSameScript bool +} + +// matchHeader has the lists of tags for exact matches and matches based on +// maximized and canonicalized tags for a given language. +type matchHeader struct { + haveTags []*haveTag + original bool +} + +// haveTag holds a supported Tag and its maximized script and region. The maximized +// or canonicalized language is not stored as it is not needed during matching. +type haveTag struct { + tag language.Tag + + // index of this tag in the original list of supported tags. + index int + + // conf is the maximum confidence that can result from matching this haveTag. + // When conf < Exact this means it was inserted after applying a CLDR equivalence rule. + conf Confidence + + // Maximized region and script. + maxRegion language.Region + maxScript language.Script + + // altScript may be checked as an alternative match to maxScript. If altScript + // matches, the confidence level for this match is Low. Theoretically there + // could be multiple alternative scripts. This does not occur in practice. + altScript language.Script + + // nextMax is the index of the next haveTag with the same maximized tags. + nextMax uint16 +} + +func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) { + max := tag + if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 { + max, _ = canonicalize(All, max) + max, _ = max.Maximize() + max.RemakeString() + } + return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID +} + +// altScript returns an alternative script that may match the given script with +// a low confidence. At the moment, the langMatch data allows for at most one +// script to map to another and we rely on this to keep the code simple. +func altScript(l language.Language, s language.Script) language.Script { + for _, alt := range matchScript { + // TODO: also match cases where language is not the same. + if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) && + language.Script(alt.haveScript) == s { + return language.Script(alt.wantScript) + } + } + return 0 +} + +// addIfNew adds a haveTag to the list of tags only if it is a unique tag. +// Tags that have the same maximized values are linked by index. +func (h *matchHeader) addIfNew(n haveTag, exact bool) { + h.original = h.original || exact + // Don't add new exact matches. + for _, v := range h.haveTags { + if equalsRest(v.tag, n.tag) { + return + } + } + // Allow duplicate maximized tags, but create a linked list to allow quickly + // comparing the equivalents and bail out. + for i, v := range h.haveTags { + if v.maxScript == n.maxScript && + v.maxRegion == n.maxRegion && + v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() { + for h.haveTags[i].nextMax != 0 { + i = int(h.haveTags[i].nextMax) + } + h.haveTags[i].nextMax = uint16(len(h.haveTags)) + break + } + } + h.haveTags = append(h.haveTags, &n) +} + +// header returns the matchHeader for the given language. It creates one if +// it doesn't already exist. +func (m *matcher) header(l language.Language) *matchHeader { + if h := m.index[l]; h != nil { + return h + } + h := &matchHeader{} + m.index[l] = h + return h +} + +func toConf(d uint8) Confidence { + if d <= 10 { + return High + } + if d < 30 { + return Low + } + return No +} + +// newMatcher builds an index for the given supported tags and returns it as +// a matcher. It also expands the index by considering various equivalence classes +// for a given tag. +func newMatcher(supported []Tag, options []MatchOption) *matcher { + m := &matcher{ + index: make(map[language.Language]*matchHeader), + preferSameScript: true, + } + for _, o := range options { + o(m) + } + if len(supported) == 0 { + m.default_ = &haveTag{} + return m + } + // Add supported languages to the index. Add exact matches first to give + // them precedence. + for i, tag := range supported { + tt := tag.tag() + pair, _ := makeHaveTag(tt, i) + m.header(tt.LangID).addIfNew(pair, true) + m.supported = append(m.supported, &pair) + } + m.default_ = m.header(supported[0].lang()).haveTags[0] + // Keep these in two different loops to support the case that two equivalent + // languages are distinguished, such as iw and he. + for i, tag := range supported { + tt := tag.tag() + pair, max := makeHaveTag(tt, i) + if max != tt.LangID { + m.header(max).addIfNew(pair, true) + } + } + + // update is used to add indexes in the map for equivalent languages. + // update will only add entries to original indexes, thus not computing any + // transitive relations. + update := func(want, have uint16, conf Confidence) { + if hh := m.index[language.Language(have)]; hh != nil { + if !hh.original { + return + } + hw := m.header(language.Language(want)) + for _, ht := range hh.haveTags { + v := *ht + if conf < v.conf { + v.conf = conf + } + v.nextMax = 0 // this value needs to be recomputed + if v.altScript != 0 { + v.altScript = altScript(language.Language(want), v.maxScript) + } + hw.addIfNew(v, conf == Exact && hh.original) + } + } + } + + // Add entries for languages with mutual intelligibility as defined by CLDR's + // languageMatch data. + for _, ml := range matchLang { + update(ml.want, ml.have, toConf(ml.distance)) + if !ml.oneway { + update(ml.have, ml.want, toConf(ml.distance)) + } + } + + // Add entries for possible canonicalizations. This is an optimization to + // ensure that only one map lookup needs to be done at runtime per desired tag. + // First we match deprecated equivalents. If they are perfect equivalents + // (their canonicalization simply substitutes a different language code, but + // nothing else), the match confidence is Exact, otherwise it is High. + for i, lm := range language.AliasMap { + // If deprecated codes match and there is no fiddling with the script + // or region, we consider it an exact match. + conf := Exact + if language.AliasTypes[i] != language.Macro { + if !isExactEquivalent(language.Language(lm.From)) { + conf = High + } + update(lm.To, lm.From, conf) + } + update(lm.From, lm.To, conf) + } + return m +} + +// getBest gets the best matching tag in m for any of the given tags, taking into +// account the order of preference of the given tags. +func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) { + best := bestMatch{} + for i, ww := range want { + w := ww.tag() + var max language.Tag + // Check for exact match first. + h := m.index[w.LangID] + if w.LangID != 0 { + if h == nil { + continue + } + // Base language is defined. + max, _ = canonicalize(Legacy|Deprecated|Macro, w) + // A region that is added through canonicalization is stronger than + // a maximized region: set it in the original (e.g. mo -> ro-MD). + if w.RegionID != max.RegionID { + w.RegionID = max.RegionID + } + // TODO: should we do the same for scripts? + // See test case: en, sr, nl ; sh ; sr + max, _ = max.Maximize() + } else { + // Base language is not defined. + if h != nil { + for i := range h.haveTags { + have := h.haveTags[i] + if equalsRest(have.tag, w) { + return have, w, Exact + } + } + } + if w.ScriptID == 0 && w.RegionID == 0 { + // We skip all tags matching und for approximate matching, including + // private tags. + continue + } + max, _ = w.Maximize() + if h = m.index[max.LangID]; h == nil { + continue + } + } + pin := true + for _, t := range want[i+1:] { + if w.LangID == t.lang() { + pin = false + break + } + } + // Check for match based on maximized tag. + for i := range h.haveTags { + have := h.haveTags[i] + best.update(have, w, max.ScriptID, max.RegionID, pin) + if best.conf == Exact { + for have.nextMax != 0 { + have = h.haveTags[have.nextMax] + best.update(have, w, max.ScriptID, max.RegionID, pin) + } + return best.have, best.want, best.conf + } + } + } + if best.conf <= No { + if len(want) != 0 { + return nil, want[0].tag(), No + } + return nil, language.Tag{}, No + } + return best.have, best.want, best.conf +} + +// bestMatch accumulates the best match so far. +type bestMatch struct { + have *haveTag + want language.Tag + conf Confidence + pinnedRegion language.Region + pinLanguage bool + sameRegionGroup bool + // Cached results from applying tie-breaking rules. + origLang bool + origReg bool + paradigmReg bool + regGroupDist uint8 + origScript bool +} + +// update updates the existing best match if the new pair is considered to be a +// better match. To determine if the given pair is a better match, it first +// computes the rough confidence level. If this surpasses the current match, it +// will replace it and update the tie-breaker rule cache. If there is a tie, it +// proceeds with applying a series of tie-breaker rules. If there is no +// conclusive winner after applying the tie-breaker rules, it leaves the current +// match as the preferred match. +// +// If pin is true and have and tag are a strong match, it will henceforth only +// consider matches for this language. This corresponds to the idea that most +// users have a strong preference for the first defined language. A user can +// still prefer a second language over a dialect of the preferred language by +// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should +// be false. +func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) { + // Bail if the maximum attainable confidence is below that of the current best match. + c := have.conf + if c < m.conf { + return + } + // Don't change the language once we already have found an exact match. + if m.pinLanguage && tag.LangID != m.want.LangID { + return + } + // Pin the region group if we are comparing tags for the same language. + if tag.LangID == m.want.LangID && m.sameRegionGroup { + _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID) + if !sameGroup { + return + } + } + if c == Exact && have.maxScript == maxScript { + // If there is another language and then another entry of this language, + // don't pin anything, otherwise pin the language. + m.pinLanguage = pin + } + if equalsRest(have.tag, tag) { + } else if have.maxScript != maxScript { + // There is usually very little comprehension between different scripts. + // In a few cases there may still be Low comprehension. This possibility + // is pre-computed and stored in have.altScript. + if Low < m.conf || have.altScript != maxScript { + return + } + c = Low + } else if have.maxRegion != maxRegion { + if High < c { + // There is usually a small difference between languages across regions. + c = High + } + } + + // We store the results of the computations of the tie-breaker rules along + // with the best match. There is no need to do the checks once we determine + // we have a winner, but we do still need to do the tie-breaker computations. + // We use "beaten" to keep track if we still need to do the checks. + beaten := false // true if the new pair defeats the current one. + if c != m.conf { + if c < m.conf { + return + } + beaten = true + } + + // Tie-breaker rules: + // We prefer if the pre-maximized language was specified and identical. + origLang := have.tag.LangID == tag.LangID && tag.LangID != 0 + if !beaten && m.origLang != origLang { + if m.origLang { + return + } + beaten = true + } + + // We prefer if the pre-maximized region was specified and identical. + origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0 + if !beaten && m.origReg != origReg { + if m.origReg { + return + } + beaten = true + } + + regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID) + if !beaten && m.regGroupDist != regGroupDist { + if regGroupDist > m.regGroupDist { + return + } + beaten = true + } + + paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion) + if !beaten && m.paradigmReg != paradigmReg { + if !paradigmReg { + return + } + beaten = true + } + + // Next we prefer if the pre-maximized script was specified and identical. + origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0 + if !beaten && m.origScript != origScript { + if m.origScript { + return + } + beaten = true + } + + // Update m to the newly found best match. + if beaten { + m.have = have + m.want = tag + m.conf = c + m.pinnedRegion = maxRegion + m.sameRegionGroup = sameGroup + m.origLang = origLang + m.origReg = origReg + m.paradigmReg = paradigmReg + m.origScript = origScript + m.regGroupDist = regGroupDist + } +} + +func isParadigmLocale(lang language.Language, r language.Region) bool { + for _, e := range paradigmLocales { + if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) { + return true + } + } + return false +} + +// regionGroupDist computes the distance between two regions based on their +// CLDR grouping. +func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) { + const defaultDistance = 4 + + aGroup := uint(regionToGroups[a]) << 1 + bGroup := uint(regionToGroups[b]) << 1 + for _, ri := range matchRegion { + if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) { + group := uint(1 << (ri.group &^ 0x80)) + if 0x80&ri.group == 0 { + if aGroup&bGroup&group != 0 { // Both regions are in the group. + return ri.distance, ri.distance == defaultDistance + } + } else { + if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. + return ri.distance, ri.distance == defaultDistance + } + } + } + } + return defaultDistance, true +} + +// equalsRest compares everything except the language. +func equalsRest(a, b language.Tag) bool { + // TODO: don't include extensions in this comparison. To do this efficiently, + // though, we should handle private tags separately. + return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags() +} + +// isExactEquivalent returns true if canonicalizing the language will not alter +// the script or region of a tag. +func isExactEquivalent(l language.Language) bool { + for _, o := range notEquivalent { + if o == l { + return false + } + } + return true +} + +var notEquivalent []language.Language + +func init() { + // Create a list of all languages for which canonicalization may alter the + // script or region. + for _, lm := range language.AliasMap { + tag := language.Tag{LangID: language.Language(lm.From)} + if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 { + notEquivalent = append(notEquivalent, language.Language(lm.From)) + } + } + // Maximize undefined regions of paradigm locales. + for i, v := range paradigmLocales { + t := language.Tag{LangID: language.Language(v[0])} + max, _ := t.Maximize() + if v[1] == 0 { + paradigmLocales[i][1] = uint16(max.RegionID) + } + if v[2] == 0 { + paradigmLocales[i][2] = uint16(max.RegionID) + } + } +} diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go new file mode 100644 index 0000000..4d57222 --- /dev/null +++ b/vendor/golang.org/x/text/language/parse.go @@ -0,0 +1,256 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "sort" + "strconv" + "strings" + + "golang.org/x/text/internal/language" +) + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError interface { + error + + // Subtag returns the subtag for which the error occurred. + Subtag() string +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the default canonicalization type. +func Parse(s string) (t Tag, err error) { + return Default.Parse(s) +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the canonicalization type c. +func (c CanonType) Parse(s string) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + tt, err := language.Parse(s) + if err != nil { + return makeTag(tt), err + } + tt, changed := canonicalize(c, tt) + if changed { + tt.RemakeString() + } + return makeTag(tt), err +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using the Default CanonType. If one or +// more errors are encountered, one of the errors is returned. +func Compose(part ...interface{}) (t Tag, err error) { + return Default.Compose(part...) +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using CanonType c. If one or more errors +// are encountered, one of the errors is returned. +func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + var b language.Builder + if err = update(&b, part...); err != nil { + return und, err + } + b.Tag, _ = canonicalize(c, b.Tag) + return makeTag(b.Make()), err +} + +var errInvalidArgument = errors.New("invalid Extension or Variant") + +func update(b *language.Builder, part ...interface{}) (err error) { + for _, x := range part { + switch v := x.(type) { + case Tag: + b.SetTag(v.tag()) + case Base: + b.Tag.LangID = v.langID + case Script: + b.Tag.ScriptID = v.scriptID + case Region: + b.Tag.RegionID = v.regionID + case Variant: + if v.variant == "" { + err = errInvalidArgument + break + } + b.AddVariant(v.variant) + case Extension: + if v.s == "" { + err = errInvalidArgument + break + } + b.SetExt(v.s) + case []Variant: + b.ClearVariants() + for _, v := range v { + b.AddVariant(v.variant) + } + case []Extension: + b.ClearExtensions() + for _, e := range v { + b.SetExt(e.s) + } + // TODO: support parsing of raw strings based on morphology or just extensions? + case error: + if v != nil { + err = v + } + } + } + return +} + +var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") +var errTagListTooLarge = errors.New("tag list exceeds max length") + +// ParseAcceptLanguage parses the contents of an Accept-Language header as +// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and +// a list of corresponding quality weights. It is more permissive than RFC 2616 +// and may return non-nil slices even if the input is not valid. +// The Tags will be sorted by highest weight first and then by first occurrence. +// Tags with a weight of zero will be dropped. An error will be returned if the +// input could not be parsed. +func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { + defer func() { + if recover() != nil { + tag = nil + q = nil + err = language.ErrSyntax + } + }() + + if strings.Count(s, "-") > 1000 { + return nil, nil, errTagListTooLarge + } + + var entry string + for s != "" { + if entry, s = split(s, ','); entry == "" { + continue + } + + entry, weight := split(entry, ';') + + // Scan the language. + t, err := Parse(entry) + if err != nil { + id, ok := acceptFallback[entry] + if !ok { + return nil, nil, err + } + t = makeTag(language.Tag{LangID: id}) + } + + // Scan the optional weight. + w := 1.0 + if weight != "" { + weight = consume(weight, 'q') + weight = consume(weight, '=') + // consume returns the empty string when a token could not be + // consumed, resulting in an error for ParseFloat. + if w, err = strconv.ParseFloat(weight, 32); err != nil { + return nil, nil, errInvalidWeight + } + // Drop tags with a quality weight of 0. + if w <= 0 { + continue + } + } + + tag = append(tag, t) + q = append(q, float32(w)) + } + sort.Stable(&tagSort{tag, q}) + return tag, q, nil +} + +// consume removes a leading token c from s and returns the result or the empty +// string if there is no such token. +func consume(s string, c byte) string { + if s == "" || s[0] != c { + return "" + } + return strings.TrimSpace(s[1:]) +} + +func split(s string, c byte) (head, tail string) { + if i := strings.IndexByte(s, c); i >= 0 { + return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:]) + } + return strings.TrimSpace(s), "" +} + +// Add hack mapping to deal with a small number of cases that occur +// in Accept-Language (with reasonable frequency). +var acceptFallback = map[string]language.Language{ + "english": _en, + "deutsch": _de, + "italian": _it, + "french": _fr, + "*": _mul, // defined in the spec to match all languages. +} + +type tagSort struct { + tag []Tag + q []float32 +} + +func (s *tagSort) Len() int { + return len(s.q) +} + +func (s *tagSort) Less(i, j int) bool { + return s.q[i] > s.q[j] +} + +func (s *tagSort) Swap(i, j int) { + s.tag[i], s.tag[j] = s.tag[j], s.tag[i] + s.q[i], s.q[j] = s.q[j], s.q[i] +} diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go new file mode 100644 index 0000000..a6573dc --- /dev/null +++ b/vendor/golang.org/x/text/language/tables.go @@ -0,0 +1,298 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const ( + _de = 269 + _en = 313 + _fr = 350 + _it = 505 + _mo = 784 + _no = 879 + _nb = 839 + _pt = 960 + _sh = 1031 + _mul = 806 + _und = 0 +) +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 +) +const ( + _Latn = 91 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 +) + +var regionToGroups = []uint8{ // 359 elements + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, + // Entry 40 - 7F + 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, + // Entry C0 - FF + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, + // Entry 140 - 17F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes + +var paradigmLocales = [][3]uint16{ // 3 elements + 0: [3]uint16{0x139, 0x0, 0x7c}, + 1: [3]uint16{0x13e, 0x0, 0x1f}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, +} // Size: 42 bytes + +type mutualIntelligibility struct { + want uint16 + have uint16 + distance uint8 + oneway bool +} +type scriptIntelligibility struct { + wantLang uint16 + haveLang uint16 + wantScript uint8 + haveScript uint8 + distance uint8 +} +type regionIntelligibility struct { + lang uint16 + script uint8 + group uint8 + distance uint8 +} + +// matchLang holds pairs of langIDs of base languages that are typically +// mutually intelligible. Each pair is associated with a confidence and +// whether the intelligibility goes one or both ways. +var matchLang = []mutualIntelligibility{ // 113 elements + 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false}, + 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false}, + 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false}, + 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false}, + 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false}, + 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true}, + 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true}, + 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false}, + 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false}, + 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true}, + 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true}, + 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true}, + 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true}, + 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true}, + 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true}, + 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true}, + 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true}, + 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true}, + 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true}, + 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true}, + 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true}, + 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true}, + 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, + 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true}, + 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true}, + 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true}, + 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true}, + 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true}, + 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true}, + 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true}, + 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true}, + 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true}, + 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true}, + 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true}, + 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true}, + 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true}, + 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true}, + 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true}, + 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true}, + 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true}, + 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true}, + 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true}, + 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true}, + 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true}, + 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true}, + 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true}, + 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true}, + 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true}, + 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true}, + 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true}, + 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true}, + 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true}, + 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true}, + 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true}, + 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true}, + 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true}, + 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true}, + 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true}, + 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true}, + 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true}, + 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true}, + 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true}, + 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true}, + 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true}, + 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true}, + 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true}, + 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true}, + 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true}, + 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true}, + 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true}, + 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true}, + 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false}, + 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true}, + 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true}, + 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true}, + 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true}, + 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true}, + 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true}, + 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true}, + 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true}, + 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true}, + 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true}, + 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true}, + 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true}, + 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true}, + 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true}, + 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true}, + 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true}, + 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true}, + 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true}, + 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true}, + 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true}, + 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true}, + 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true}, + 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true}, + 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true}, + 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true}, + 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true}, + 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true}, + 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true}, + 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true}, + 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true}, + 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true}, + 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true}, + 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true}, + 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true}, + 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true}, + 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true}, + 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true}, + 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true}, + 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true}, + 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true}, + 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true}, +} // Size: 702 bytes + +// matchScript holds pairs of scriptIDs where readers of one script +// can typically also read the other. Each is associated with a confidence. +var matchScript = []scriptIntelligibility{ // 26 elements + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, + 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, + 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, + 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, +} // Size: 232 bytes + +var matchRegion = []regionIntelligibility{ // 15 elements + 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, + 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, + 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4}, + 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4}, + 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4}, + 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4}, + 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4}, + 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4}, + 8: {lang: 0x529, script: 0x3c, group: 0x2, distance: 0x4}, + 9: {lang: 0x529, script: 0x3c, group: 0x82, distance: 0x4}, + 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, + 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5}, + 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5}, + 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5}, + 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, +} // Size: 114 bytes + +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go new file mode 100644 index 0000000..42ea792 --- /dev/null +++ b/vendor/golang.org/x/text/language/tags.go @@ -0,0 +1,145 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "golang.org/x/text/internal/language/compact" + +// TODO: Various sets of commonly use tags and regions. + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func (c CanonType) MustParse(s string) Tag { + t, err := c.Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Base { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag(compact.Afrikaans) + Amharic Tag = Tag(compact.Amharic) + Arabic Tag = Tag(compact.Arabic) + ModernStandardArabic Tag = Tag(compact.ModernStandardArabic) + Azerbaijani Tag = Tag(compact.Azerbaijani) + Bulgarian Tag = Tag(compact.Bulgarian) + Bengali Tag = Tag(compact.Bengali) + Catalan Tag = Tag(compact.Catalan) + Czech Tag = Tag(compact.Czech) + Danish Tag = Tag(compact.Danish) + German Tag = Tag(compact.German) + Greek Tag = Tag(compact.Greek) + English Tag = Tag(compact.English) + AmericanEnglish Tag = Tag(compact.AmericanEnglish) + BritishEnglish Tag = Tag(compact.BritishEnglish) + Spanish Tag = Tag(compact.Spanish) + EuropeanSpanish Tag = Tag(compact.EuropeanSpanish) + LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish) + Estonian Tag = Tag(compact.Estonian) + Persian Tag = Tag(compact.Persian) + Finnish Tag = Tag(compact.Finnish) + Filipino Tag = Tag(compact.Filipino) + French Tag = Tag(compact.French) + CanadianFrench Tag = Tag(compact.CanadianFrench) + Gujarati Tag = Tag(compact.Gujarati) + Hebrew Tag = Tag(compact.Hebrew) + Hindi Tag = Tag(compact.Hindi) + Croatian Tag = Tag(compact.Croatian) + Hungarian Tag = Tag(compact.Hungarian) + Armenian Tag = Tag(compact.Armenian) + Indonesian Tag = Tag(compact.Indonesian) + Icelandic Tag = Tag(compact.Icelandic) + Italian Tag = Tag(compact.Italian) + Japanese Tag = Tag(compact.Japanese) + Georgian Tag = Tag(compact.Georgian) + Kazakh Tag = Tag(compact.Kazakh) + Khmer Tag = Tag(compact.Khmer) + Kannada Tag = Tag(compact.Kannada) + Korean Tag = Tag(compact.Korean) + Kirghiz Tag = Tag(compact.Kirghiz) + Lao Tag = Tag(compact.Lao) + Lithuanian Tag = Tag(compact.Lithuanian) + Latvian Tag = Tag(compact.Latvian) + Macedonian Tag = Tag(compact.Macedonian) + Malayalam Tag = Tag(compact.Malayalam) + Mongolian Tag = Tag(compact.Mongolian) + Marathi Tag = Tag(compact.Marathi) + Malay Tag = Tag(compact.Malay) + Burmese Tag = Tag(compact.Burmese) + Nepali Tag = Tag(compact.Nepali) + Dutch Tag = Tag(compact.Dutch) + Norwegian Tag = Tag(compact.Norwegian) + Punjabi Tag = Tag(compact.Punjabi) + Polish Tag = Tag(compact.Polish) + Portuguese Tag = Tag(compact.Portuguese) + BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese) + EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese) + Romanian Tag = Tag(compact.Romanian) + Russian Tag = Tag(compact.Russian) + Sinhala Tag = Tag(compact.Sinhala) + Slovak Tag = Tag(compact.Slovak) + Slovenian Tag = Tag(compact.Slovenian) + Albanian Tag = Tag(compact.Albanian) + Serbian Tag = Tag(compact.Serbian) + SerbianLatin Tag = Tag(compact.SerbianLatin) + Swedish Tag = Tag(compact.Swedish) + Swahili Tag = Tag(compact.Swahili) + Tamil Tag = Tag(compact.Tamil) + Telugu Tag = Tag(compact.Telugu) + Thai Tag = Tag(compact.Thai) + Turkish Tag = Tag(compact.Turkish) + Ukrainian Tag = Tag(compact.Ukrainian) + Urdu Tag = Tag(compact.Urdu) + Uzbek Tag = Tag(compact.Uzbek) + Vietnamese Tag = Tag(compact.Vietnamese) + Chinese Tag = Tag(compact.Chinese) + SimplifiedChinese Tag = Tag(compact.SimplifiedChinese) + TraditionalChinese Tag = Tag(compact.TraditionalChinese) + Zulu Tag = Tag(compact.Zulu) +) diff --git a/vendor/golang.org/x/text/message/catalog.go b/vendor/golang.org/x/text/message/catalog.go new file mode 100644 index 0000000..068271d --- /dev/null +++ b/vendor/golang.org/x/text/message/catalog.go @@ -0,0 +1,36 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package message + +// TODO: some types in this file will need to be made public at some time. +// Documentation and method names will reflect this by using the exported name. + +import ( + "golang.org/x/text/language" + "golang.org/x/text/message/catalog" +) + +// MatchLanguage reports the matched tag obtained from language.MatchStrings for +// the Matcher of the DefaultCatalog. +func MatchLanguage(preferred ...string) language.Tag { + c := DefaultCatalog + tag, _ := language.MatchStrings(c.Matcher(), preferred...) + return tag +} + +// DefaultCatalog is used by SetString. +var DefaultCatalog catalog.Catalog = defaultCatalog + +var defaultCatalog = catalog.NewBuilder() + +// SetString calls SetString on the initial default Catalog. +func SetString(tag language.Tag, key string, msg string) error { + return defaultCatalog.SetString(tag, key, msg) +} + +// Set calls Set on the initial default Catalog. +func Set(tag language.Tag, key string, msg ...catalog.Message) error { + return defaultCatalog.Set(tag, key, msg...) +} diff --git a/vendor/golang.org/x/text/message/catalog/catalog.go b/vendor/golang.org/x/text/message/catalog/catalog.go new file mode 100644 index 0000000..96955d0 --- /dev/null +++ b/vendor/golang.org/x/text/message/catalog/catalog.go @@ -0,0 +1,365 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package catalog defines collections of translated format strings. +// +// This package mostly defines types for populating catalogs with messages. The +// catmsg package contains further definitions for creating custom message and +// dictionary types as well as packages that use Catalogs. +// +// Package catalog defines various interfaces: Dictionary, Loader, and Message. +// A Dictionary maintains a set of translations of format strings for a single +// language. The Loader interface defines a source of dictionaries. A +// translation of a format string is represented by a Message. +// +// # Catalogs +// +// A Catalog defines a programmatic interface for setting message translations. +// It maintains a set of per-language dictionaries with translations for a set +// of keys. For message translation to function properly, a translation should +// be defined for each key for each supported language. A dictionary may be +// underspecified, though, if there is a parent language that already defines +// the key. For example, a Dictionary for "en-GB" could leave out entries that +// are identical to those in a dictionary for "en". +// +// # Messages +// +// A Message is a format string which varies on the value of substitution +// variables. For instance, to indicate the number of results one could want "no +// results" if there are none, "1 result" if there is 1, and "%d results" for +// any other number. Catalog is agnostic to the kind of format strings that are +// used: for instance, messages can follow either the printf-style substitution +// from package fmt or use templates. +// +// A Message does not substitute arguments in the format string. This job is +// reserved for packages that render strings, such as message, that use Catalogs +// to selected string. This separation of concerns allows Catalog to be used to +// store any kind of formatting strings. +// +// # Selecting messages based on linguistic features of substitution arguments +// +// Messages may vary based on any linguistic features of the argument values. +// The most common one is plural form, but others exist. +// +// Selection messages are provided in packages that provide support for a +// specific linguistic feature. The following snippet uses plural.Selectf: +// +// catalog.Set(language.English, "You are %d minute(s) late.", +// plural.Selectf(1, "", +// plural.One, "You are 1 minute late.", +// plural.Other, "You are %d minutes late.")) +// +// In this example, a message is stored in the Catalog where one of two messages +// is selected based on the first argument, a number. The first message is +// selected if the argument is singular (identified by the selector "one") and +// the second message is selected in all other cases. The selectors are defined +// by the plural rules defined in CLDR. The selector "other" is special and will +// always match. Each language always defines one of the linguistic categories +// to be "other." For English, singular is "one" and plural is "other". +// +// Selects can be nested. This allows selecting sentences based on features of +// multiple arguments or multiple linguistic properties of a single argument. +// +// # String interpolation +// +// There is often a lot of commonality between the possible variants of a +// message. For instance, in the example above the word "minute" varies based on +// the plural catogory of the argument, but the rest of the sentence is +// identical. Using interpolation the above message can be rewritten as: +// +// catalog.Set(language.English, "You are %d minute(s) late.", +// catalog.Var("minutes", +// plural.Selectf(1, "", plural.One, "minute", plural.Other, "minutes")), +// catalog.String("You are %[1]d ${minutes} late.")) +// +// Var is defined to return the variable name if the message does not yield a +// match. This allows us to further simplify this snippet to +// +// catalog.Set(language.English, "You are %d minute(s) late.", +// catalog.Var("minutes", plural.Selectf(1, "", plural.One, "minute")), +// catalog.String("You are %d ${minutes} late.")) +// +// Overall this is still only a minor improvement, but things can get a lot more +// unwieldy if more than one linguistic feature is used to determine a message +// variant. Consider the following example: +// +// // argument 1: list of hosts, argument 2: list of guests +// catalog.Set(language.English, "%[1]v invite(s) %[2]v to their party.", +// catalog.Var("their", +// plural.Selectf(1, "" +// plural.One, gender.Select(1, "female", "her", "other", "his"))), +// catalog.Var("invites", plural.Selectf(1, "", plural.One, "invite")) +// catalog.String("%[1]v ${invites} %[2]v to ${their} party.")), +// +// Without variable substitution, this would have to be written as +// +// // argument 1: list of hosts, argument 2: list of guests +// catalog.Set(language.English, "%[1]v invite(s) %[2]v to their party.", +// plural.Selectf(1, "", +// plural.One, gender.Select(1, +// "female", "%[1]v invites %[2]v to her party." +// "other", "%[1]v invites %[2]v to his party."), +// plural.Other, "%[1]v invites %[2]v to their party.")) +// +// Not necessarily shorter, but using variables there is less duplication and +// the messages are more maintenance friendly. Moreover, languages may have up +// to six plural forms. This makes the use of variables more welcome. +// +// Different messages using the same inflections can reuse variables by moving +// them to macros. Using macros we can rewrite the message as: +// +// // argument 1: list of hosts, argument 2: list of guests +// catalog.SetString(language.English, "%[1]v invite(s) %[2]v to their party.", +// "%[1]v ${invites(1)} %[2]v to ${their(1)} party.") +// +// Where the following macros were defined separately. +// +// catalog.SetMacro(language.English, "invites", plural.Selectf(1, "", +// plural.One, "invite")) +// catalog.SetMacro(language.English, "their", plural.Selectf(1, "", +// plural.One, gender.Select(1, "female", "her", "other", "his"))), +// +// Placeholders use parentheses and the arguments to invoke a macro. +// +// # Looking up messages +// +// Message lookup using Catalogs is typically only done by specialized packages +// and is not something the user should be concerned with. For instance, to +// express the tardiness of a user using the related message we defined earlier, +// the user may use the package message like so: +// +// p := message.NewPrinter(language.English) +// p.Printf("You are %d minute(s) late.", 5) +// +// Which would print: +// +// You are 5 minutes late. +// +// This package is UNDER CONSTRUCTION and its API may change. +package catalog // import "golang.org/x/text/message/catalog" + +// TODO: +// Some way to freeze a catalog. +// - Locking on each lockup turns out to be about 50% of the total running time +// for some of the benchmarks in the message package. +// Consider these: +// - Sequence type to support sequences in user-defined messages. +// - Garbage collection: Remove dictionaries that can no longer be reached +// as other dictionaries have been added that cover all possible keys. + +import ( + "errors" + "fmt" + + "golang.org/x/text/internal" + + "golang.org/x/text/internal/catmsg" + "golang.org/x/text/language" +) + +// A Catalog allows lookup of translated messages. +type Catalog interface { + // Languages returns all languages for which the Catalog contains variants. + Languages() []language.Tag + + // Matcher returns a Matcher for languages from this Catalog. + Matcher() language.Matcher + + // A Context is used for evaluating Messages. + Context(tag language.Tag, r catmsg.Renderer) *Context + + // This method also makes Catalog a private interface. + lookup(tag language.Tag, key string) (data string, ok bool) +} + +// NewFromMap creates a Catalog from the given map. If a Dictionary is +// underspecified the entry is retrieved from a parent language. +func NewFromMap(dictionaries map[string]Dictionary, opts ...Option) (Catalog, error) { + options := options{} + for _, o := range opts { + o(&options) + } + c := &catalog{ + dicts: map[language.Tag]Dictionary{}, + } + _, hasFallback := dictionaries[options.fallback.String()] + if hasFallback { + // TODO: Should it be okay to not have a fallback language? + // Catalog generators could enforce there is always a fallback. + c.langs = append(c.langs, options.fallback) + } + for lang, dict := range dictionaries { + tag, err := language.Parse(lang) + if err != nil { + return nil, fmt.Errorf("catalog: invalid language tag %q", lang) + } + if _, ok := c.dicts[tag]; ok { + return nil, fmt.Errorf("catalog: duplicate entry for tag %q after normalization", tag) + } + c.dicts[tag] = dict + if !hasFallback || tag != options.fallback { + c.langs = append(c.langs, tag) + } + } + if hasFallback { + internal.SortTags(c.langs[1:]) + } else { + internal.SortTags(c.langs) + } + c.matcher = language.NewMatcher(c.langs) + return c, nil +} + +// A Dictionary is a source of translations for a single language. +type Dictionary interface { + // Lookup returns a message compiled with catmsg.Compile for the given key. + // It returns false for ok if such a message could not be found. + Lookup(key string) (data string, ok bool) +} + +type catalog struct { + langs []language.Tag + dicts map[language.Tag]Dictionary + macros store + matcher language.Matcher +} + +func (c *catalog) Languages() []language.Tag { return c.langs } +func (c *catalog) Matcher() language.Matcher { return c.matcher } + +func (c *catalog) lookup(tag language.Tag, key string) (data string, ok bool) { + for ; ; tag = tag.Parent() { + if dict, ok := c.dicts[tag]; ok { + if data, ok := dict.Lookup(key); ok { + return data, true + } + } + if tag == language.Und { + break + } + } + return "", false +} + +// Context returns a Context for formatting messages. +// Only one Message may be formatted per context at any given time. +func (c *catalog) Context(tag language.Tag, r catmsg.Renderer) *Context { + return &Context{ + cat: c, + tag: tag, + dec: catmsg.NewDecoder(tag, r, &dict{&c.macros, tag}), + } +} + +// A Builder allows building a Catalog programmatically. +type Builder struct { + options + matcher language.Matcher + + index store + macros store +} + +type options struct { + fallback language.Tag +} + +// An Option configures Catalog behavior. +type Option func(*options) + +// Fallback specifies the default fallback language. The default is Und. +func Fallback(tag language.Tag) Option { + return func(o *options) { o.fallback = tag } +} + +// TODO: +// // Catalogs specifies one or more sources for a Catalog. +// // Lookups are in order. +// // This can be changed inserting a Catalog used for setting, which implements +// // Loader, used for setting in the chain. +// func Catalogs(d ...Loader) Option { +// return nil +// } +// +// func Delims(start, end string) Option {} +// +// func Dict(tag language.Tag, d ...Dictionary) Option + +// NewBuilder returns an empty mutable Catalog. +func NewBuilder(opts ...Option) *Builder { + c := &Builder{} + for _, o := range opts { + o(&c.options) + } + return c +} + +// SetString is shorthand for Set(tag, key, String(msg)). +func (c *Builder) SetString(tag language.Tag, key string, msg string) error { + return c.set(tag, key, &c.index, String(msg)) +} + +// Set sets the translation for the given language and key. +// +// When evaluation this message, the first Message in the sequence to msgs to +// evaluate to a string will be the message returned. +func (c *Builder) Set(tag language.Tag, key string, msg ...Message) error { + return c.set(tag, key, &c.index, msg...) +} + +// SetMacro defines a Message that may be substituted in another message. +// The arguments to a macro Message are passed as arguments in the +// placeholder the form "${foo(arg1, arg2)}". +func (c *Builder) SetMacro(tag language.Tag, name string, msg ...Message) error { + return c.set(tag, name, &c.macros, msg...) +} + +// ErrNotFound indicates there was no message for the given key. +var ErrNotFound = errors.New("catalog: message not found") + +// String specifies a plain message string. It can be used as fallback if no +// other strings match or as a simple standalone message. +// +// It is an error to pass more than one String in a message sequence. +func String(name string) Message { + return catmsg.String(name) +} + +// Var sets a variable that may be substituted in formatting patterns using +// named substitution of the form "${name}". The name argument is used as a +// fallback if the statements do not produce a match. The statement sequence may +// not contain any Var calls. +// +// The name passed to a Var must be unique within message sequence. +func Var(name string, msg ...Message) Message { + return &catmsg.Var{Name: name, Message: firstInSequence(msg)} +} + +// Context returns a Context for formatting messages. +// Only one Message may be formatted per context at any given time. +func (b *Builder) Context(tag language.Tag, r catmsg.Renderer) *Context { + return &Context{ + cat: b, + tag: tag, + dec: catmsg.NewDecoder(tag, r, &dict{&b.macros, tag}), + } +} + +// A Context is used for evaluating Messages. +// Only one Message may be formatted per context at any given time. +type Context struct { + cat Catalog + tag language.Tag // TODO: use compact index. + dec *catmsg.Decoder +} + +// Execute looks up and executes the message with the given key. +// It returns ErrNotFound if no message could be found in the index. +func (c *Context) Execute(key string) error { + data, ok := c.cat.lookup(c.tag, key) + if !ok { + return ErrNotFound + } + return c.dec.Execute(data) +} diff --git a/vendor/golang.org/x/text/message/catalog/dict.go b/vendor/golang.org/x/text/message/catalog/dict.go new file mode 100644 index 0000000..a0eb818 --- /dev/null +++ b/vendor/golang.org/x/text/message/catalog/dict.go @@ -0,0 +1,129 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package catalog + +import ( + "sync" + + "golang.org/x/text/internal" + "golang.org/x/text/internal/catmsg" + "golang.org/x/text/language" +) + +// TODO: +// Dictionary returns a Dictionary that returns the first Message, using the +// given language tag, that matches: +// 1. the last one registered by one of the Set methods +// 2. returned by one of the Loaders +// 3. repeat from 1. using the parent language +// This approach allows messages to be underspecified. +// func (c *Catalog) Dictionary(tag language.Tag) (Dictionary, error) { +// // TODO: verify dictionary exists. +// return &dict{&c.index, tag}, nil +// } + +type dict struct { + s *store + tag language.Tag // TODO: make compact tag. +} + +func (d *dict) Lookup(key string) (data string, ok bool) { + return d.s.lookup(d.tag, key) +} + +func (b *Builder) lookup(tag language.Tag, key string) (data string, ok bool) { + return b.index.lookup(tag, key) +} + +func (c *Builder) set(tag language.Tag, key string, s *store, msg ...Message) error { + data, err := catmsg.Compile(tag, &dict{&c.macros, tag}, firstInSequence(msg)) + + s.mutex.Lock() + defer s.mutex.Unlock() + + m := s.index[tag] + if m == nil { + m = msgMap{} + if s.index == nil { + s.index = map[language.Tag]msgMap{} + } + c.matcher = nil + s.index[tag] = m + } + + m[key] = data + return err +} + +func (c *Builder) Matcher() language.Matcher { + c.index.mutex.RLock() + m := c.matcher + c.index.mutex.RUnlock() + if m != nil { + return m + } + + c.index.mutex.Lock() + if c.matcher == nil { + c.matcher = language.NewMatcher(c.unlockedLanguages()) + } + m = c.matcher + c.index.mutex.Unlock() + return m +} + +type store struct { + mutex sync.RWMutex + index map[language.Tag]msgMap +} + +type msgMap map[string]string + +func (s *store) lookup(tag language.Tag, key string) (data string, ok bool) { + s.mutex.RLock() + defer s.mutex.RUnlock() + + for ; ; tag = tag.Parent() { + if msgs, ok := s.index[tag]; ok { + if msg, ok := msgs[key]; ok { + return msg, true + } + } + if tag == language.Und { + break + } + } + return "", false +} + +// Languages returns all languages for which the Catalog contains variants. +func (b *Builder) Languages() []language.Tag { + s := &b.index + s.mutex.RLock() + defer s.mutex.RUnlock() + + return b.unlockedLanguages() +} + +func (b *Builder) unlockedLanguages() []language.Tag { + s := &b.index + if len(s.index) == 0 { + return nil + } + tags := make([]language.Tag, 0, len(s.index)) + _, hasFallback := s.index[b.options.fallback] + offset := 0 + if hasFallback { + tags = append(tags, b.options.fallback) + offset = 1 + } + for t := range s.index { + if t != b.options.fallback { + tags = append(tags, t) + } + } + internal.SortTags(tags[offset:]) + return tags +} diff --git a/vendor/golang.org/x/text/message/catalog/go19.go b/vendor/golang.org/x/text/message/catalog/go19.go new file mode 100644 index 0000000..291a4df --- /dev/null +++ b/vendor/golang.org/x/text/message/catalog/go19.go @@ -0,0 +1,15 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build go1.9 + +package catalog + +import "golang.org/x/text/internal/catmsg" + +// A Message holds a collection of translations for the same phrase that may +// vary based on the values of substitution arguments. +type Message = catmsg.Message + +type firstInSequence = catmsg.FirstOf diff --git a/vendor/golang.org/x/text/message/catalog/gopre19.go b/vendor/golang.org/x/text/message/catalog/gopre19.go new file mode 100644 index 0000000..da44ebb --- /dev/null +++ b/vendor/golang.org/x/text/message/catalog/gopre19.go @@ -0,0 +1,23 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build !go1.9 + +package catalog + +import "golang.org/x/text/internal/catmsg" + +// A Message holds a collection of translations for the same phrase that may +// vary based on the values of substitution arguments. +type Message interface { + catmsg.Message +} + +func firstInSequence(m []Message) catmsg.Message { + a := []catmsg.Message{} + for _, m := range m { + a = append(a, m) + } + return catmsg.FirstOf(a) +} diff --git a/vendor/golang.org/x/text/message/doc.go b/vendor/golang.org/x/text/message/doc.go new file mode 100644 index 0000000..4bf7bdc --- /dev/null +++ b/vendor/golang.org/x/text/message/doc.go @@ -0,0 +1,99 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package message implements formatted I/O for localized strings with functions +// analogous to the fmt's print functions. It is a drop-in replacement for fmt. +// +// # Localized Formatting +// +// A format string can be localized by replacing any of the print functions of +// fmt with an equivalent call to a Printer. +// +// p := message.NewPrinter(message.MatchLanguage("en")) +// p.Println(123456.78) // Prints 123,456.78 +// +// p.Printf("%d ducks in a row", 4331) // Prints 4,331 ducks in a row +// +// p := message.NewPrinter(message.MatchLanguage("nl")) +// p.Printf("Hoogte: %.1f meter", 1244.9) // Prints Hoogte: 1,244.9 meter +// +// p := message.NewPrinter(message.MatchLanguage("bn")) +// p.Println(123456.78) // Prints ১,২৩,৪৫৬.৭৮ +// +// Printer currently supports numbers and specialized types for which packages +// exist in x/text. Other builtin types such as time.Time and slices are +// planned. +// +// Format strings largely have the same meaning as with fmt with the following +// notable exceptions: +// - flag # always resorts to fmt for printing +// - verb 'f', 'e', 'g', 'd' use localized formatting unless the '#' flag is +// specified. +// - verb 'm' inserts a translation of a string argument. +// +// See package fmt for more options. +// +// # Translation +// +// The format strings that are passed to Printf, Sprintf, Fprintf, or Errorf +// are used as keys to look up translations for the specified languages. +// More on how these need to be specified below. +// +// One can use arbitrary keys to distinguish between otherwise ambiguous +// strings: +// +// p := message.NewPrinter(language.English) +// p.Printf("archive(noun)") // Prints "archive" +// p.Printf("archive(verb)") // Prints "archive" +// +// p := message.NewPrinter(language.German) +// p.Printf("archive(noun)") // Prints "Archiv" +// p.Printf("archive(verb)") // Prints "archivieren" +// +// To retain the fallback functionality, use Key: +// +// p.Printf(message.Key("archive(noun)", "archive")) +// p.Printf(message.Key("archive(verb)", "archive")) +// +// # Translation Pipeline +// +// Format strings that contain text need to be translated to support different +// locales. The first step is to extract strings that need to be translated. +// +// 1. Install gotext +// +// go get -u golang.org/x/text/cmd/gotext +// gotext -help +// +// 2. Mark strings in your source to be translated by using message.Printer, +// instead of the functions of the fmt package. +// +// 3. Extract the strings from your source +// +// gotext extract +// +// The output will be written to the textdata directory. +// +// 4. Send the files for translation +// +// It is planned to support multiple formats, but for now one will have to +// rewrite the JSON output to the desired format. +// +// 5. Inject translations into program +// +// 6. Repeat from 2 +// +// Right now this has to be done programmatically with calls to Set or +// SetString. These functions as well as the methods defined in +// see also package golang.org/x/text/message/catalog can be used to implement +// either dynamic or static loading of messages. +// +// # Plural and Gender Forms +// +// Translated messages can vary based on the plural and gender forms of +// substitution values. In general, it is up to the translators to provide +// alternative translations for such forms. See the packages in +// golang.org/x/text/feature and golang.org/x/text/message/catalog for more +// information. +package message diff --git a/vendor/golang.org/x/text/message/format.go b/vendor/golang.org/x/text/message/format.go new file mode 100644 index 0000000..a47d17d --- /dev/null +++ b/vendor/golang.org/x/text/message/format.go @@ -0,0 +1,510 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package message + +import ( + "bytes" + "strconv" + "unicode/utf8" + + "golang.org/x/text/internal/format" +) + +const ( + ldigits = "0123456789abcdefx" + udigits = "0123456789ABCDEFX" +) + +const ( + signed = true + unsigned = false +) + +// A formatInfo is the raw formatter used by Printf etc. +// It prints into a buffer that must be set up separately. +type formatInfo struct { + buf *bytes.Buffer + + format.Parser + + // intbuf is large enough to store %b of an int64 with a sign and + // avoids padding at the end of the struct on 32 bit architectures. + intbuf [68]byte +} + +func (f *formatInfo) init(buf *bytes.Buffer) { + f.ClearFlags() + f.buf = buf +} + +// writePadding generates n bytes of padding. +func (f *formatInfo) writePadding(n int) { + if n <= 0 { // No padding bytes needed. + return + } + f.buf.Grow(n) + // Decide which byte the padding should be filled with. + padByte := byte(' ') + if f.Zero { + padByte = byte('0') + } + // Fill padding with padByte. + for i := 0; i < n; i++ { + f.buf.WriteByte(padByte) // TODO: make more efficient. + } +} + +// pad appends b to f.buf, padded on left (!f.minus) or right (f.minus). +func (f *formatInfo) pad(b []byte) { + if !f.WidthPresent || f.Width == 0 { + f.buf.Write(b) + return + } + width := f.Width - utf8.RuneCount(b) + if !f.Minus { + // left padding + f.writePadding(width) + f.buf.Write(b) + } else { + // right padding + f.buf.Write(b) + f.writePadding(width) + } +} + +// padString appends s to f.buf, padded on left (!f.minus) or right (f.minus). +func (f *formatInfo) padString(s string) { + if !f.WidthPresent || f.Width == 0 { + f.buf.WriteString(s) + return + } + width := f.Width - utf8.RuneCountInString(s) + if !f.Minus { + // left padding + f.writePadding(width) + f.buf.WriteString(s) + } else { + // right padding + f.buf.WriteString(s) + f.writePadding(width) + } +} + +// fmt_boolean formats a boolean. +func (f *formatInfo) fmt_boolean(v bool) { + if v { + f.padString("true") + } else { + f.padString("false") + } +} + +// fmt_unicode formats a uint64 as "U+0078" or with f.sharp set as "U+0078 'x'". +func (f *formatInfo) fmt_unicode(u uint64) { + buf := f.intbuf[0:] + + // With default precision set the maximum needed buf length is 18 + // for formatting -1 with %#U ("U+FFFFFFFFFFFFFFFF") which fits + // into the already allocated intbuf with a capacity of 68 bytes. + prec := 4 + if f.PrecPresent && f.Prec > 4 { + prec = f.Prec + // Compute space needed for "U+" , number, " '", character, "'". + width := 2 + prec + 2 + utf8.UTFMax + 1 + if width > len(buf) { + buf = make([]byte, width) + } + } + + // Format into buf, ending at buf[i]. Formatting numbers is easier right-to-left. + i := len(buf) + + // For %#U we want to add a space and a quoted character at the end of the buffer. + if f.Sharp && u <= utf8.MaxRune && strconv.IsPrint(rune(u)) { + i-- + buf[i] = '\'' + i -= utf8.RuneLen(rune(u)) + utf8.EncodeRune(buf[i:], rune(u)) + i-- + buf[i] = '\'' + i-- + buf[i] = ' ' + } + // Format the Unicode code point u as a hexadecimal number. + for u >= 16 { + i-- + buf[i] = udigits[u&0xF] + prec-- + u >>= 4 + } + i-- + buf[i] = udigits[u] + prec-- + // Add zeros in front of the number until requested precision is reached. + for prec > 0 { + i-- + buf[i] = '0' + prec-- + } + // Add a leading "U+". + i-- + buf[i] = '+' + i-- + buf[i] = 'U' + + oldZero := f.Zero + f.Zero = false + f.pad(buf[i:]) + f.Zero = oldZero +} + +// fmt_integer formats signed and unsigned integers. +func (f *formatInfo) fmt_integer(u uint64, base int, isSigned bool, digits string) { + negative := isSigned && int64(u) < 0 + if negative { + u = -u + } + + buf := f.intbuf[0:] + // The already allocated f.intbuf with a capacity of 68 bytes + // is large enough for integer formatting when no precision or width is set. + if f.WidthPresent || f.PrecPresent { + // Account 3 extra bytes for possible addition of a sign and "0x". + width := 3 + f.Width + f.Prec // wid and prec are always positive. + if width > len(buf) { + // We're going to need a bigger boat. + buf = make([]byte, width) + } + } + + // Two ways to ask for extra leading zero digits: %.3d or %03d. + // If both are specified the f.zero flag is ignored and + // padding with spaces is used instead. + prec := 0 + if f.PrecPresent { + prec = f.Prec + // Precision of 0 and value of 0 means "print nothing" but padding. + if prec == 0 && u == 0 { + oldZero := f.Zero + f.Zero = false + f.writePadding(f.Width) + f.Zero = oldZero + return + } + } else if f.Zero && f.WidthPresent { + prec = f.Width + if negative || f.Plus || f.Space { + prec-- // leave room for sign + } + } + + // Because printing is easier right-to-left: format u into buf, ending at buf[i]. + // We could make things marginally faster by splitting the 32-bit case out + // into a separate block but it's not worth the duplication, so u has 64 bits. + i := len(buf) + // Use constants for the division and modulo for more efficient code. + // Switch cases ordered by popularity. + switch base { + case 10: + for u >= 10 { + i-- + next := u / 10 + buf[i] = byte('0' + u - next*10) + u = next + } + case 16: + for u >= 16 { + i-- + buf[i] = digits[u&0xF] + u >>= 4 + } + case 8: + for u >= 8 { + i-- + buf[i] = byte('0' + u&7) + u >>= 3 + } + case 2: + for u >= 2 { + i-- + buf[i] = byte('0' + u&1) + u >>= 1 + } + default: + panic("fmt: unknown base; can't happen") + } + i-- + buf[i] = digits[u] + for i > 0 && prec > len(buf)-i { + i-- + buf[i] = '0' + } + + // Various prefixes: 0x, -, etc. + if f.Sharp { + switch base { + case 8: + if buf[i] != '0' { + i-- + buf[i] = '0' + } + case 16: + // Add a leading 0x or 0X. + i-- + buf[i] = digits[16] + i-- + buf[i] = '0' + } + } + + if negative { + i-- + buf[i] = '-' + } else if f.Plus { + i-- + buf[i] = '+' + } else if f.Space { + i-- + buf[i] = ' ' + } + + // Left padding with zeros has already been handled like precision earlier + // or the f.zero flag is ignored due to an explicitly set precision. + oldZero := f.Zero + f.Zero = false + f.pad(buf[i:]) + f.Zero = oldZero +} + +// truncate truncates the string to the specified precision, if present. +func (f *formatInfo) truncate(s string) string { + if f.PrecPresent { + n := f.Prec + for i := range s { + n-- + if n < 0 { + return s[:i] + } + } + } + return s +} + +// fmt_s formats a string. +func (f *formatInfo) fmt_s(s string) { + s = f.truncate(s) + f.padString(s) +} + +// fmt_sbx formats a string or byte slice as a hexadecimal encoding of its bytes. +func (f *formatInfo) fmt_sbx(s string, b []byte, digits string) { + length := len(b) + if b == nil { + // No byte slice present. Assume string s should be encoded. + length = len(s) + } + // Set length to not process more bytes than the precision demands. + if f.PrecPresent && f.Prec < length { + length = f.Prec + } + // Compute width of the encoding taking into account the f.sharp and f.space flag. + width := 2 * length + if width > 0 { + if f.Space { + // Each element encoded by two hexadecimals will get a leading 0x or 0X. + if f.Sharp { + width *= 2 + } + // Elements will be separated by a space. + width += length - 1 + } else if f.Sharp { + // Only a leading 0x or 0X will be added for the whole string. + width += 2 + } + } else { // The byte slice or string that should be encoded is empty. + if f.WidthPresent { + f.writePadding(f.Width) + } + return + } + // Handle padding to the left. + if f.WidthPresent && f.Width > width && !f.Minus { + f.writePadding(f.Width - width) + } + // Write the encoding directly into the output buffer. + buf := f.buf + if f.Sharp { + // Add leading 0x or 0X. + buf.WriteByte('0') + buf.WriteByte(digits[16]) + } + var c byte + for i := 0; i < length; i++ { + if f.Space && i > 0 { + // Separate elements with a space. + buf.WriteByte(' ') + if f.Sharp { + // Add leading 0x or 0X for each element. + buf.WriteByte('0') + buf.WriteByte(digits[16]) + } + } + if b != nil { + c = b[i] // Take a byte from the input byte slice. + } else { + c = s[i] // Take a byte from the input string. + } + // Encode each byte as two hexadecimal digits. + buf.WriteByte(digits[c>>4]) + buf.WriteByte(digits[c&0xF]) + } + // Handle padding to the right. + if f.WidthPresent && f.Width > width && f.Minus { + f.writePadding(f.Width - width) + } +} + +// fmt_sx formats a string as a hexadecimal encoding of its bytes. +func (f *formatInfo) fmt_sx(s, digits string) { + f.fmt_sbx(s, nil, digits) +} + +// fmt_bx formats a byte slice as a hexadecimal encoding of its bytes. +func (f *formatInfo) fmt_bx(b []byte, digits string) { + f.fmt_sbx("", b, digits) +} + +// fmt_q formats a string as a double-quoted, escaped Go string constant. +// If f.sharp is set a raw (backquoted) string may be returned instead +// if the string does not contain any control characters other than tab. +func (f *formatInfo) fmt_q(s string) { + s = f.truncate(s) + if f.Sharp && strconv.CanBackquote(s) { + f.padString("`" + s + "`") + return + } + buf := f.intbuf[:0] + if f.Plus { + f.pad(strconv.AppendQuoteToASCII(buf, s)) + } else { + f.pad(strconv.AppendQuote(buf, s)) + } +} + +// fmt_c formats an integer as a Unicode character. +// If the character is not valid Unicode, it will print '\ufffd'. +func (f *formatInfo) fmt_c(c uint64) { + r := rune(c) + if c > utf8.MaxRune { + r = utf8.RuneError + } + buf := f.intbuf[:0] + w := utf8.EncodeRune(buf[:utf8.UTFMax], r) + f.pad(buf[:w]) +} + +// fmt_qc formats an integer as a single-quoted, escaped Go character constant. +// If the character is not valid Unicode, it will print '\ufffd'. +func (f *formatInfo) fmt_qc(c uint64) { + r := rune(c) + if c > utf8.MaxRune { + r = utf8.RuneError + } + buf := f.intbuf[:0] + if f.Plus { + f.pad(strconv.AppendQuoteRuneToASCII(buf, r)) + } else { + f.pad(strconv.AppendQuoteRune(buf, r)) + } +} + +// fmt_float formats a float64. It assumes that verb is a valid format specifier +// for strconv.AppendFloat and therefore fits into a byte. +func (f *formatInfo) fmt_float(v float64, size int, verb rune, prec int) { + // Explicit precision in format specifier overrules default precision. + if f.PrecPresent { + prec = f.Prec + } + // Format number, reserving space for leading + sign if needed. + num := strconv.AppendFloat(f.intbuf[:1], v, byte(verb), prec, size) + if num[1] == '-' || num[1] == '+' { + num = num[1:] + } else { + num[0] = '+' + } + // f.space means to add a leading space instead of a "+" sign unless + // the sign is explicitly asked for by f.plus. + if f.Space && num[0] == '+' && !f.Plus { + num[0] = ' ' + } + // Special handling for infinities and NaN, + // which don't look like a number so shouldn't be padded with zeros. + if num[1] == 'I' || num[1] == 'N' { + oldZero := f.Zero + f.Zero = false + // Remove sign before NaN if not asked for. + if num[1] == 'N' && !f.Space && !f.Plus { + num = num[1:] + } + f.pad(num) + f.Zero = oldZero + return + } + // The sharp flag forces printing a decimal point for non-binary formats + // and retains trailing zeros, which we may need to restore. + if f.Sharp && verb != 'b' { + digits := 0 + switch verb { + case 'v', 'g', 'G': + digits = prec + // If no precision is set explicitly use a precision of 6. + if digits == -1 { + digits = 6 + } + } + + // Buffer pre-allocated with enough room for + // exponent notations of the form "e+123". + var tailBuf [5]byte + tail := tailBuf[:0] + + hasDecimalPoint := false + // Starting from i = 1 to skip sign at num[0]. + for i := 1; i < len(num); i++ { + switch num[i] { + case '.': + hasDecimalPoint = true + case 'e', 'E': + tail = append(tail, num[i:]...) + num = num[:i] + default: + digits-- + } + } + if !hasDecimalPoint { + num = append(num, '.') + } + for digits > 0 { + num = append(num, '0') + digits-- + } + num = append(num, tail...) + } + // We want a sign if asked for and if the sign is not positive. + if f.Plus || num[0] != '+' { + // If we're zero padding to the left we want the sign before the leading zeros. + // Achieve this by writing the sign out and then padding the unsigned number. + if f.Zero && f.WidthPresent && f.Width > len(num) { + f.buf.WriteByte(num[0]) + f.writePadding(f.Width - len(num)) + f.buf.Write(num[1:]) + return + } + f.pad(num) + return + } + // No sign to show and the number is positive; just print the unsigned number. + f.pad(num[1:]) +} diff --git a/vendor/golang.org/x/text/message/message.go b/vendor/golang.org/x/text/message/message.go new file mode 100644 index 0000000..48d7663 --- /dev/null +++ b/vendor/golang.org/x/text/message/message.go @@ -0,0 +1,193 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package message // import "golang.org/x/text/message" + +import ( + "io" + "os" + + // Include features to facilitate generated catalogs. + _ "golang.org/x/text/feature/plural" + + "golang.org/x/text/internal/number" + "golang.org/x/text/language" + "golang.org/x/text/message/catalog" +) + +// A Printer implements language-specific formatted I/O analogous to the fmt +// package. +type Printer struct { + // the language + tag language.Tag + + toDecimal number.Formatter + toScientific number.Formatter + + cat catalog.Catalog +} + +type options struct { + cat catalog.Catalog + // TODO: + // - allow %s to print integers in written form (tables are likely too large + // to enable this by default). + // - list behavior + // +} + +// An Option defines an option of a Printer. +type Option func(o *options) + +// Catalog defines the catalog to be used. +func Catalog(c catalog.Catalog) Option { + return func(o *options) { o.cat = c } +} + +// NewPrinter returns a Printer that formats messages tailored to language t. +func NewPrinter(t language.Tag, opts ...Option) *Printer { + options := &options{ + cat: DefaultCatalog, + } + for _, o := range opts { + o(options) + } + p := &Printer{ + tag: t, + cat: options.cat, + } + p.toDecimal.InitDecimal(t) + p.toScientific.InitScientific(t) + return p +} + +// Sprint is like fmt.Sprint, but using language-specific formatting. +func (p *Printer) Sprint(a ...interface{}) string { + pp := newPrinter(p) + pp.doPrint(a) + s := pp.String() + pp.free() + return s +} + +// Fprint is like fmt.Fprint, but using language-specific formatting. +func (p *Printer) Fprint(w io.Writer, a ...interface{}) (n int, err error) { + pp := newPrinter(p) + pp.doPrint(a) + n64, err := io.Copy(w, &pp.Buffer) + pp.free() + return int(n64), err +} + +// Print is like fmt.Print, but using language-specific formatting. +func (p *Printer) Print(a ...interface{}) (n int, err error) { + return p.Fprint(os.Stdout, a...) +} + +// Sprintln is like fmt.Sprintln, but using language-specific formatting. +func (p *Printer) Sprintln(a ...interface{}) string { + pp := newPrinter(p) + pp.doPrintln(a) + s := pp.String() + pp.free() + return s +} + +// Fprintln is like fmt.Fprintln, but using language-specific formatting. +func (p *Printer) Fprintln(w io.Writer, a ...interface{}) (n int, err error) { + pp := newPrinter(p) + pp.doPrintln(a) + n64, err := io.Copy(w, &pp.Buffer) + pp.free() + return int(n64), err +} + +// Println is like fmt.Println, but using language-specific formatting. +func (p *Printer) Println(a ...interface{}) (n int, err error) { + return p.Fprintln(os.Stdout, a...) +} + +// Sprintf is like fmt.Sprintf, but using language-specific formatting. +func (p *Printer) Sprintf(key Reference, a ...interface{}) string { + pp := newPrinter(p) + lookupAndFormat(pp, key, a) + s := pp.String() + pp.free() + return s +} + +// Fprintf is like fmt.Fprintf, but using language-specific formatting. +func (p *Printer) Fprintf(w io.Writer, key Reference, a ...interface{}) (n int, err error) { + pp := newPrinter(p) + lookupAndFormat(pp, key, a) + n, err = w.Write(pp.Bytes()) + pp.free() + return n, err + +} + +// Printf is like fmt.Printf, but using language-specific formatting. +func (p *Printer) Printf(key Reference, a ...interface{}) (n int, err error) { + pp := newPrinter(p) + lookupAndFormat(pp, key, a) + n, err = os.Stdout.Write(pp.Bytes()) + pp.free() + return n, err +} + +func lookupAndFormat(p *printer, r Reference, a []interface{}) { + p.fmt.Reset(a) + var id, msg string + switch v := r.(type) { + case string: + id, msg = v, v + case key: + id, msg = v.id, v.fallback + default: + panic("key argument is not a Reference") + } + + if p.catContext.Execute(id) == catalog.ErrNotFound { + if p.catContext.Execute(msg) == catalog.ErrNotFound { + p.Render(msg) + return + } + } +} + +type rawPrinter struct { + p *printer +} + +func (p rawPrinter) Render(msg string) { p.p.WriteString(msg) } +func (p rawPrinter) Arg(i int) interface{} { return nil } + +// Arg implements catmsg.Renderer. +func (p *printer) Arg(i int) interface{} { // TODO, also return "ok" bool + i-- + if uint(i) < uint(len(p.fmt.Args)) { + return p.fmt.Args[i] + } + return nil +} + +// Render implements catmsg.Renderer. +func (p *printer) Render(msg string) { + p.doPrintf(msg) +} + +// A Reference is a string or a message reference. +type Reference interface { + // TODO: also allow []string +} + +// Key creates a message Reference for a message where the given id is used for +// message lookup and the fallback is returned when no matches are found. +func Key(id string, fallback string) Reference { + return key{id, fallback} +} + +type key struct { + id, fallback string +} diff --git a/vendor/golang.org/x/text/message/print.go b/vendor/golang.org/x/text/message/print.go new file mode 100644 index 0000000..da304cc --- /dev/null +++ b/vendor/golang.org/x/text/message/print.go @@ -0,0 +1,984 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package message + +import ( + "bytes" + "fmt" // TODO: consider copying interfaces from package fmt to avoid dependency. + "math" + "reflect" + "sync" + "unicode/utf8" + + "golang.org/x/text/internal/format" + "golang.org/x/text/internal/number" + "golang.org/x/text/language" + "golang.org/x/text/message/catalog" +) + +// Strings for use with buffer.WriteString. +// This is less overhead than using buffer.Write with byte arrays. +const ( + commaSpaceString = ", " + nilAngleString = "" + nilParenString = "(nil)" + nilString = "nil" + mapString = "map[" + percentBangString = "%!" + missingString = "(MISSING)" + badIndexString = "(BADINDEX)" + panicString = "(PANIC=" + extraString = "%!(EXTRA " + badWidthString = "%!(BADWIDTH)" + badPrecString = "%!(BADPREC)" + noVerbString = "%!(NOVERB)" + + invReflectString = "" +) + +var printerPool = sync.Pool{ + New: func() interface{} { return new(printer) }, +} + +// newPrinter allocates a new printer struct or grabs a cached one. +func newPrinter(pp *Printer) *printer { + p := printerPool.Get().(*printer) + p.Printer = *pp + // TODO: cache most of the following call. + p.catContext = pp.cat.Context(pp.tag, p) + + p.panicking = false + p.erroring = false + p.fmt.init(&p.Buffer) + return p +} + +// free saves used printer structs in printerFree; avoids an allocation per invocation. +func (p *printer) free() { + p.Buffer.Reset() + p.arg = nil + p.value = reflect.Value{} + printerPool.Put(p) +} + +// printer is used to store a printer's state. +// It implements "golang.org/x/text/internal/format".State. +type printer struct { + Printer + + // the context for looking up message translations + catContext *catalog.Context + + // buffer for accumulating output. + bytes.Buffer + + // arg holds the current item, as an interface{}. + arg interface{} + // value is used instead of arg for reflect values. + value reflect.Value + + // fmt is used to format basic items such as integers or strings. + fmt formatInfo + + // panicking is set by catchPanic to avoid infinite panic, recover, panic, ... recursion. + panicking bool + // erroring is set when printing an error string to guard against calling handleMethods. + erroring bool +} + +// Language implements "golang.org/x/text/internal/format".State. +func (p *printer) Language() language.Tag { return p.tag } + +func (p *printer) Width() (wid int, ok bool) { return p.fmt.Width, p.fmt.WidthPresent } + +func (p *printer) Precision() (prec int, ok bool) { return p.fmt.Prec, p.fmt.PrecPresent } + +func (p *printer) Flag(b int) bool { + switch b { + case '-': + return p.fmt.Minus + case '+': + return p.fmt.Plus || p.fmt.PlusV + case '#': + return p.fmt.Sharp || p.fmt.SharpV + case ' ': + return p.fmt.Space + case '0': + return p.fmt.Zero + } + return false +} + +// getField gets the i'th field of the struct value. +// If the field is itself is an interface, return a value for +// the thing inside the interface, not the interface itself. +func getField(v reflect.Value, i int) reflect.Value { + val := v.Field(i) + if val.Kind() == reflect.Interface && !val.IsNil() { + val = val.Elem() + } + return val +} + +func (p *printer) unknownType(v reflect.Value) { + if !v.IsValid() { + p.WriteString(nilAngleString) + return + } + p.WriteByte('?') + p.WriteString(v.Type().String()) + p.WriteByte('?') +} + +func (p *printer) badVerb(verb rune) { + p.erroring = true + p.WriteString(percentBangString) + p.WriteRune(verb) + p.WriteByte('(') + switch { + case p.arg != nil: + p.WriteString(reflect.TypeOf(p.arg).String()) + p.WriteByte('=') + p.printArg(p.arg, 'v') + case p.value.IsValid(): + p.WriteString(p.value.Type().String()) + p.WriteByte('=') + p.printValue(p.value, 'v', 0) + default: + p.WriteString(nilAngleString) + } + p.WriteByte(')') + p.erroring = false +} + +func (p *printer) fmtBool(v bool, verb rune) { + switch verb { + case 't', 'v': + p.fmt.fmt_boolean(v) + default: + p.badVerb(verb) + } +} + +// fmt0x64 formats a uint64 in hexadecimal and prefixes it with 0x or +// not, as requested, by temporarily setting the sharp flag. +func (p *printer) fmt0x64(v uint64, leading0x bool) { + sharp := p.fmt.Sharp + p.fmt.Sharp = leading0x + p.fmt.fmt_integer(v, 16, unsigned, ldigits) + p.fmt.Sharp = sharp +} + +// fmtInteger formats a signed or unsigned integer. +func (p *printer) fmtInteger(v uint64, isSigned bool, verb rune) { + switch verb { + case 'v': + if p.fmt.SharpV && !isSigned { + p.fmt0x64(v, true) + return + } + fallthrough + case 'd': + if p.fmt.Sharp || p.fmt.SharpV { + p.fmt.fmt_integer(v, 10, isSigned, ldigits) + } else { + p.fmtDecimalInt(v, isSigned) + } + case 'b': + p.fmt.fmt_integer(v, 2, isSigned, ldigits) + case 'o': + p.fmt.fmt_integer(v, 8, isSigned, ldigits) + case 'x': + p.fmt.fmt_integer(v, 16, isSigned, ldigits) + case 'X': + p.fmt.fmt_integer(v, 16, isSigned, udigits) + case 'c': + p.fmt.fmt_c(v) + case 'q': + if v <= utf8.MaxRune { + p.fmt.fmt_qc(v) + } else { + p.badVerb(verb) + } + case 'U': + p.fmt.fmt_unicode(v) + default: + p.badVerb(verb) + } +} + +// fmtFloat formats a float. The default precision for each verb +// is specified as last argument in the call to fmt_float. +func (p *printer) fmtFloat(v float64, size int, verb rune) { + switch verb { + case 'b': + p.fmt.fmt_float(v, size, verb, -1) + case 'v': + verb = 'g' + fallthrough + case 'g', 'G': + if p.fmt.Sharp || p.fmt.SharpV { + p.fmt.fmt_float(v, size, verb, -1) + } else { + p.fmtVariableFloat(v, size) + } + case 'e', 'E': + if p.fmt.Sharp || p.fmt.SharpV { + p.fmt.fmt_float(v, size, verb, 6) + } else { + p.fmtScientific(v, size, 6) + } + case 'f', 'F': + if p.fmt.Sharp || p.fmt.SharpV { + p.fmt.fmt_float(v, size, verb, 6) + } else { + p.fmtDecimalFloat(v, size, 6) + } + default: + p.badVerb(verb) + } +} + +func (p *printer) setFlags(f *number.Formatter) { + f.Flags &^= number.ElideSign + if p.fmt.Plus || p.fmt.Space { + f.Flags |= number.AlwaysSign + if !p.fmt.Plus { + f.Flags |= number.ElideSign + } + } else { + f.Flags &^= number.AlwaysSign + } +} + +func (p *printer) updatePadding(f *number.Formatter) { + f.Flags &^= number.PadMask + if p.fmt.Minus { + f.Flags |= number.PadAfterSuffix + } else { + f.Flags |= number.PadBeforePrefix + } + f.PadRune = ' ' + f.FormatWidth = uint16(p.fmt.Width) +} + +func (p *printer) initDecimal(minFrac, maxFrac int) { + f := &p.toDecimal + f.MinIntegerDigits = 1 + f.MaxIntegerDigits = 0 + f.MinFractionDigits = uint8(minFrac) + f.MaxFractionDigits = int16(maxFrac) + p.setFlags(f) + f.PadRune = 0 + if p.fmt.WidthPresent { + if p.fmt.Zero { + wid := p.fmt.Width + // Use significant integers for this. + // TODO: this is not the same as width, but so be it. + if f.MinFractionDigits > 0 { + wid -= 1 + int(f.MinFractionDigits) + } + if p.fmt.Plus || p.fmt.Space { + wid-- + } + if wid > 0 && wid > int(f.MinIntegerDigits) { + f.MinIntegerDigits = uint8(wid) + } + } + p.updatePadding(f) + } +} + +func (p *printer) initScientific(minFrac, maxFrac int) { + f := &p.toScientific + if maxFrac < 0 { + f.SetPrecision(maxFrac) + } else { + f.SetPrecision(maxFrac + 1) + f.MinFractionDigits = uint8(minFrac) + f.MaxFractionDigits = int16(maxFrac) + } + f.MinExponentDigits = 2 + p.setFlags(f) + f.PadRune = 0 + if p.fmt.WidthPresent { + f.Flags &^= number.PadMask + if p.fmt.Zero { + f.PadRune = f.Digit(0) + f.Flags |= number.PadAfterPrefix + } else { + f.PadRune = ' ' + f.Flags |= number.PadBeforePrefix + } + p.updatePadding(f) + } +} + +func (p *printer) fmtDecimalInt(v uint64, isSigned bool) { + var d number.Decimal + + f := &p.toDecimal + if p.fmt.PrecPresent { + p.setFlags(f) + f.MinIntegerDigits = uint8(p.fmt.Prec) + f.MaxIntegerDigits = 0 + f.MinFractionDigits = 0 + f.MaxFractionDigits = 0 + if p.fmt.WidthPresent { + p.updatePadding(f) + } + } else { + p.initDecimal(0, 0) + } + d.ConvertInt(p.toDecimal.RoundingContext, isSigned, v) + + out := p.toDecimal.Format([]byte(nil), &d) + p.Buffer.Write(out) +} + +func (p *printer) fmtDecimalFloat(v float64, size, prec int) { + var d number.Decimal + if p.fmt.PrecPresent { + prec = p.fmt.Prec + } + p.initDecimal(prec, prec) + d.ConvertFloat(p.toDecimal.RoundingContext, v, size) + + out := p.toDecimal.Format([]byte(nil), &d) + p.Buffer.Write(out) +} + +func (p *printer) fmtVariableFloat(v float64, size int) { + prec := -1 + if p.fmt.PrecPresent { + prec = p.fmt.Prec + } + var d number.Decimal + p.initScientific(0, prec) + d.ConvertFloat(p.toScientific.RoundingContext, v, size) + + // Copy logic of 'g' formatting from strconv. It is simplified a bit as + // we don't have to mind having prec > len(d.Digits). + shortest := prec < 0 + ePrec := prec + if shortest { + prec = len(d.Digits) + ePrec = 6 + } else if prec == 0 { + prec = 1 + ePrec = 1 + } + exp := int(d.Exp) - 1 + if exp < -4 || exp >= ePrec { + p.initScientific(0, prec) + + out := p.toScientific.Format([]byte(nil), &d) + p.Buffer.Write(out) + } else { + if prec > int(d.Exp) { + prec = len(d.Digits) + } + if prec -= int(d.Exp); prec < 0 { + prec = 0 + } + p.initDecimal(0, prec) + + out := p.toDecimal.Format([]byte(nil), &d) + p.Buffer.Write(out) + } +} + +func (p *printer) fmtScientific(v float64, size, prec int) { + var d number.Decimal + if p.fmt.PrecPresent { + prec = p.fmt.Prec + } + p.initScientific(prec, prec) + rc := p.toScientific.RoundingContext + d.ConvertFloat(rc, v, size) + + out := p.toScientific.Format([]byte(nil), &d) + p.Buffer.Write(out) + +} + +// fmtComplex formats a complex number v with +// r = real(v) and j = imag(v) as (r+ji) using +// fmtFloat for r and j formatting. +func (p *printer) fmtComplex(v complex128, size int, verb rune) { + // Make sure any unsupported verbs are found before the + // calls to fmtFloat to not generate an incorrect error string. + switch verb { + case 'v', 'b', 'g', 'G', 'f', 'F', 'e', 'E': + p.WriteByte('(') + p.fmtFloat(real(v), size/2, verb) + // Imaginary part always has a sign. + if math.IsNaN(imag(v)) { + // By CLDR's rules, NaNs do not use patterns or signs. As this code + // relies on AlwaysSign working for imaginary parts, we need to + // manually handle NaNs. + f := &p.toScientific + p.setFlags(f) + p.updatePadding(f) + p.setFlags(f) + nan := f.Symbol(number.SymNan) + extra := 0 + if w, ok := p.Width(); ok { + extra = w - utf8.RuneCountInString(nan) - 1 + } + if f.Flags&number.PadAfterNumber == 0 { + for ; extra > 0; extra-- { + p.WriteRune(f.PadRune) + } + } + p.WriteString(f.Symbol(number.SymPlusSign)) + p.WriteString(nan) + for ; extra > 0; extra-- { + p.WriteRune(f.PadRune) + } + p.WriteString("i)") + return + } + oldPlus := p.fmt.Plus + p.fmt.Plus = true + p.fmtFloat(imag(v), size/2, verb) + p.WriteString("i)") // TODO: use symbol? + p.fmt.Plus = oldPlus + default: + p.badVerb(verb) + } +} + +func (p *printer) fmtString(v string, verb rune) { + switch verb { + case 'v': + if p.fmt.SharpV { + p.fmt.fmt_q(v) + } else { + p.fmt.fmt_s(v) + } + case 's': + p.fmt.fmt_s(v) + case 'x': + p.fmt.fmt_sx(v, ldigits) + case 'X': + p.fmt.fmt_sx(v, udigits) + case 'q': + p.fmt.fmt_q(v) + case 'm': + ctx := p.cat.Context(p.tag, rawPrinter{p}) + if ctx.Execute(v) == catalog.ErrNotFound { + p.WriteString(v) + } + default: + p.badVerb(verb) + } +} + +func (p *printer) fmtBytes(v []byte, verb rune, typeString string) { + switch verb { + case 'v', 'd': + if p.fmt.SharpV { + p.WriteString(typeString) + if v == nil { + p.WriteString(nilParenString) + return + } + p.WriteByte('{') + for i, c := range v { + if i > 0 { + p.WriteString(commaSpaceString) + } + p.fmt0x64(uint64(c), true) + } + p.WriteByte('}') + } else { + p.WriteByte('[') + for i, c := range v { + if i > 0 { + p.WriteByte(' ') + } + p.fmt.fmt_integer(uint64(c), 10, unsigned, ldigits) + } + p.WriteByte(']') + } + case 's': + p.fmt.fmt_s(string(v)) + case 'x': + p.fmt.fmt_bx(v, ldigits) + case 'X': + p.fmt.fmt_bx(v, udigits) + case 'q': + p.fmt.fmt_q(string(v)) + default: + p.printValue(reflect.ValueOf(v), verb, 0) + } +} + +func (p *printer) fmtPointer(value reflect.Value, verb rune) { + var u uintptr + switch value.Kind() { + case reflect.Chan, reflect.Func, reflect.Map, reflect.Ptr, reflect.Slice, reflect.UnsafePointer: + u = value.Pointer() + default: + p.badVerb(verb) + return + } + + switch verb { + case 'v': + if p.fmt.SharpV { + p.WriteByte('(') + p.WriteString(value.Type().String()) + p.WriteString(")(") + if u == 0 { + p.WriteString(nilString) + } else { + p.fmt0x64(uint64(u), true) + } + p.WriteByte(')') + } else { + if u == 0 { + p.fmt.padString(nilAngleString) + } else { + p.fmt0x64(uint64(u), !p.fmt.Sharp) + } + } + case 'p': + p.fmt0x64(uint64(u), !p.fmt.Sharp) + case 'b', 'o', 'd', 'x', 'X': + if verb == 'd' { + p.fmt.Sharp = true // Print as standard go. TODO: does this make sense? + } + p.fmtInteger(uint64(u), unsigned, verb) + default: + p.badVerb(verb) + } +} + +func (p *printer) catchPanic(arg interface{}, verb rune) { + if err := recover(); err != nil { + // If it's a nil pointer, just say "". The likeliest causes are a + // Stringer that fails to guard against nil or a nil pointer for a + // value receiver, and in either case, "" is a nice result. + if v := reflect.ValueOf(arg); v.Kind() == reflect.Ptr && v.IsNil() { + p.WriteString(nilAngleString) + return + } + // Otherwise print a concise panic message. Most of the time the panic + // value will print itself nicely. + if p.panicking { + // Nested panics; the recursion in printArg cannot succeed. + panic(err) + } + + oldFlags := p.fmt.Parser + // For this output we want default behavior. + p.fmt.ClearFlags() + + p.WriteString(percentBangString) + p.WriteRune(verb) + p.WriteString(panicString) + p.panicking = true + p.printArg(err, 'v') + p.panicking = false + p.WriteByte(')') + + p.fmt.Parser = oldFlags + } +} + +func (p *printer) handleMethods(verb rune) (handled bool) { + if p.erroring { + return + } + // Is it a Formatter? + if formatter, ok := p.arg.(format.Formatter); ok { + handled = true + defer p.catchPanic(p.arg, verb) + formatter.Format(p, verb) + return + } + if formatter, ok := p.arg.(fmt.Formatter); ok { + handled = true + defer p.catchPanic(p.arg, verb) + formatter.Format(p, verb) + return + } + + // If we're doing Go syntax and the argument knows how to supply it, take care of it now. + if p.fmt.SharpV { + if stringer, ok := p.arg.(fmt.GoStringer); ok { + handled = true + defer p.catchPanic(p.arg, verb) + // Print the result of GoString unadorned. + p.fmt.fmt_s(stringer.GoString()) + return + } + } else { + // If a string is acceptable according to the format, see if + // the value satisfies one of the string-valued interfaces. + // Println etc. set verb to %v, which is "stringable". + switch verb { + case 'v', 's', 'x', 'X', 'q': + // Is it an error or Stringer? + // The duplication in the bodies is necessary: + // setting handled and deferring catchPanic + // must happen before calling the method. + switch v := p.arg.(type) { + case error: + handled = true + defer p.catchPanic(p.arg, verb) + p.fmtString(v.Error(), verb) + return + + case fmt.Stringer: + handled = true + defer p.catchPanic(p.arg, verb) + p.fmtString(v.String(), verb) + return + } + } + } + return false +} + +func (p *printer) printArg(arg interface{}, verb rune) { + p.arg = arg + p.value = reflect.Value{} + + if arg == nil { + switch verb { + case 'T', 'v': + p.fmt.padString(nilAngleString) + default: + p.badVerb(verb) + } + return + } + + // Special processing considerations. + // %T (the value's type) and %p (its address) are special; we always do them first. + switch verb { + case 'T': + p.fmt.fmt_s(reflect.TypeOf(arg).String()) + return + case 'p': + p.fmtPointer(reflect.ValueOf(arg), 'p') + return + } + + // Some types can be done without reflection. + switch f := arg.(type) { + case bool: + p.fmtBool(f, verb) + case float32: + p.fmtFloat(float64(f), 32, verb) + case float64: + p.fmtFloat(f, 64, verb) + case complex64: + p.fmtComplex(complex128(f), 64, verb) + case complex128: + p.fmtComplex(f, 128, verb) + case int: + p.fmtInteger(uint64(f), signed, verb) + case int8: + p.fmtInteger(uint64(f), signed, verb) + case int16: + p.fmtInteger(uint64(f), signed, verb) + case int32: + p.fmtInteger(uint64(f), signed, verb) + case int64: + p.fmtInteger(uint64(f), signed, verb) + case uint: + p.fmtInteger(uint64(f), unsigned, verb) + case uint8: + p.fmtInteger(uint64(f), unsigned, verb) + case uint16: + p.fmtInteger(uint64(f), unsigned, verb) + case uint32: + p.fmtInteger(uint64(f), unsigned, verb) + case uint64: + p.fmtInteger(f, unsigned, verb) + case uintptr: + p.fmtInteger(uint64(f), unsigned, verb) + case string: + p.fmtString(f, verb) + case []byte: + p.fmtBytes(f, verb, "[]byte") + case reflect.Value: + // Handle extractable values with special methods + // since printValue does not handle them at depth 0. + if f.IsValid() && f.CanInterface() { + p.arg = f.Interface() + if p.handleMethods(verb) { + return + } + } + p.printValue(f, verb, 0) + default: + // If the type is not simple, it might have methods. + if !p.handleMethods(verb) { + // Need to use reflection, since the type had no + // interface methods that could be used for formatting. + p.printValue(reflect.ValueOf(f), verb, 0) + } + } +} + +// printValue is similar to printArg but starts with a reflect value, not an interface{} value. +// It does not handle 'p' and 'T' verbs because these should have been already handled by printArg. +func (p *printer) printValue(value reflect.Value, verb rune, depth int) { + // Handle values with special methods if not already handled by printArg (depth == 0). + if depth > 0 && value.IsValid() && value.CanInterface() { + p.arg = value.Interface() + if p.handleMethods(verb) { + return + } + } + p.arg = nil + p.value = value + + switch f := value; value.Kind() { + case reflect.Invalid: + if depth == 0 { + p.WriteString(invReflectString) + } else { + switch verb { + case 'v': + p.WriteString(nilAngleString) + default: + p.badVerb(verb) + } + } + case reflect.Bool: + p.fmtBool(f.Bool(), verb) + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + p.fmtInteger(uint64(f.Int()), signed, verb) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + p.fmtInteger(f.Uint(), unsigned, verb) + case reflect.Float32: + p.fmtFloat(f.Float(), 32, verb) + case reflect.Float64: + p.fmtFloat(f.Float(), 64, verb) + case reflect.Complex64: + p.fmtComplex(f.Complex(), 64, verb) + case reflect.Complex128: + p.fmtComplex(f.Complex(), 128, verb) + case reflect.String: + p.fmtString(f.String(), verb) + case reflect.Map: + if p.fmt.SharpV { + p.WriteString(f.Type().String()) + if f.IsNil() { + p.WriteString(nilParenString) + return + } + p.WriteByte('{') + } else { + p.WriteString(mapString) + } + keys := f.MapKeys() + for i, key := range keys { + if i > 0 { + if p.fmt.SharpV { + p.WriteString(commaSpaceString) + } else { + p.WriteByte(' ') + } + } + p.printValue(key, verb, depth+1) + p.WriteByte(':') + p.printValue(f.MapIndex(key), verb, depth+1) + } + if p.fmt.SharpV { + p.WriteByte('}') + } else { + p.WriteByte(']') + } + case reflect.Struct: + if p.fmt.SharpV { + p.WriteString(f.Type().String()) + } + p.WriteByte('{') + for i := 0; i < f.NumField(); i++ { + if i > 0 { + if p.fmt.SharpV { + p.WriteString(commaSpaceString) + } else { + p.WriteByte(' ') + } + } + if p.fmt.PlusV || p.fmt.SharpV { + if name := f.Type().Field(i).Name; name != "" { + p.WriteString(name) + p.WriteByte(':') + } + } + p.printValue(getField(f, i), verb, depth+1) + } + p.WriteByte('}') + case reflect.Interface: + value := f.Elem() + if !value.IsValid() { + if p.fmt.SharpV { + p.WriteString(f.Type().String()) + p.WriteString(nilParenString) + } else { + p.WriteString(nilAngleString) + } + } else { + p.printValue(value, verb, depth+1) + } + case reflect.Array, reflect.Slice: + switch verb { + case 's', 'q', 'x', 'X': + // Handle byte and uint8 slices and arrays special for the above verbs. + t := f.Type() + if t.Elem().Kind() == reflect.Uint8 { + var bytes []byte + if f.Kind() == reflect.Slice { + bytes = f.Bytes() + } else if f.CanAddr() { + bytes = f.Slice(0, f.Len()).Bytes() + } else { + // We have an array, but we cannot Slice() a non-addressable array, + // so we build a slice by hand. This is a rare case but it would be nice + // if reflection could help a little more. + bytes = make([]byte, f.Len()) + for i := range bytes { + bytes[i] = byte(f.Index(i).Uint()) + } + } + p.fmtBytes(bytes, verb, t.String()) + return + } + } + if p.fmt.SharpV { + p.WriteString(f.Type().String()) + if f.Kind() == reflect.Slice && f.IsNil() { + p.WriteString(nilParenString) + return + } + p.WriteByte('{') + for i := 0; i < f.Len(); i++ { + if i > 0 { + p.WriteString(commaSpaceString) + } + p.printValue(f.Index(i), verb, depth+1) + } + p.WriteByte('}') + } else { + p.WriteByte('[') + for i := 0; i < f.Len(); i++ { + if i > 0 { + p.WriteByte(' ') + } + p.printValue(f.Index(i), verb, depth+1) + } + p.WriteByte(']') + } + case reflect.Ptr: + // pointer to array or slice or struct? ok at top level + // but not embedded (avoid loops) + if depth == 0 && f.Pointer() != 0 { + switch a := f.Elem(); a.Kind() { + case reflect.Array, reflect.Slice, reflect.Struct, reflect.Map: + p.WriteByte('&') + p.printValue(a, verb, depth+1) + return + } + } + fallthrough + case reflect.Chan, reflect.Func, reflect.UnsafePointer: + p.fmtPointer(f, verb) + default: + p.unknownType(f) + } +} + +func (p *printer) badArgNum(verb rune) { + p.WriteString(percentBangString) + p.WriteRune(verb) + p.WriteString(badIndexString) +} + +func (p *printer) missingArg(verb rune) { + p.WriteString(percentBangString) + p.WriteRune(verb) + p.WriteString(missingString) +} + +func (p *printer) doPrintf(fmt string) { + for p.fmt.Parser.SetFormat(fmt); p.fmt.Scan(); { + switch p.fmt.Status { + case format.StatusText: + p.WriteString(p.fmt.Text()) + case format.StatusSubstitution: + p.printArg(p.Arg(p.fmt.ArgNum), p.fmt.Verb) + case format.StatusBadWidthSubstitution: + p.WriteString(badWidthString) + p.printArg(p.Arg(p.fmt.ArgNum), p.fmt.Verb) + case format.StatusBadPrecSubstitution: + p.WriteString(badPrecString) + p.printArg(p.Arg(p.fmt.ArgNum), p.fmt.Verb) + case format.StatusNoVerb: + p.WriteString(noVerbString) + case format.StatusBadArgNum: + p.badArgNum(p.fmt.Verb) + case format.StatusMissingArg: + p.missingArg(p.fmt.Verb) + default: + panic("unreachable") + } + } + + // Check for extra arguments, but only if there was at least one ordered + // argument. Note that this behavior is necessarily different from fmt: + // different variants of messages may opt to drop some or all of the + // arguments. + if !p.fmt.Reordered && p.fmt.ArgNum < len(p.fmt.Args) && p.fmt.ArgNum != 0 { + p.fmt.ClearFlags() + p.WriteString(extraString) + for i, arg := range p.fmt.Args[p.fmt.ArgNum:] { + if i > 0 { + p.WriteString(commaSpaceString) + } + if arg == nil { + p.WriteString(nilAngleString) + } else { + p.WriteString(reflect.TypeOf(arg).String()) + p.WriteString("=") + p.printArg(arg, 'v') + } + } + p.WriteByte(')') + } +} + +func (p *printer) doPrint(a []interface{}) { + prevString := false + for argNum, arg := range a { + isString := arg != nil && reflect.TypeOf(arg).Kind() == reflect.String + // Add a space between two non-string arguments. + if argNum > 0 && !isString && !prevString { + p.WriteByte(' ') + } + p.printArg(arg, 'v') + prevString = isString + } +} + +// doPrintln is like doPrint but always adds a space between arguments +// and a newline after the last argument. +func (p *printer) doPrintln(a []interface{}) { + for argNum, arg := range a { + if argNum > 0 { + p.WriteByte(' ') + } + p.printArg(arg, 'v') + } + p.WriteByte('\n') +} diff --git a/vendor/modules.txt b/vendor/modules.txt new file mode 100644 index 0000000..d1472b3 --- /dev/null +++ b/vendor/modules.txt @@ -0,0 +1,30 @@ +# github.com/caarlos0/env/v10 v10.0.0 +## explicit; go 1.17 +github.com/caarlos0/env/v10 +# github.com/google/go-cmp v0.6.0 +## explicit; go 1.13 +github.com/google/go-cmp/cmp +github.com/google/go-cmp/cmp/internal/diff +github.com/google/go-cmp/cmp/internal/flags +github.com/google/go-cmp/cmp/internal/function +github.com/google/go-cmp/cmp/internal/value +# github.com/valyala/bytebufferpool v1.0.0 +## explicit +github.com/valyala/bytebufferpool +# github.com/valyala/quicktemplate v1.7.0 +## explicit; go 1.11 +github.com/valyala/quicktemplate +# golang.org/x/text v0.14.0 +## explicit; go 1.18 +golang.org/x/text/feature/plural +golang.org/x/text/internal +golang.org/x/text/internal/catmsg +golang.org/x/text/internal/format +golang.org/x/text/internal/language +golang.org/x/text/internal/language/compact +golang.org/x/text/internal/number +golang.org/x/text/internal/stringset +golang.org/x/text/internal/tag +golang.org/x/text/language +golang.org/x/text/message +golang.org/x/text/message/catalog